TBLASTN 2.2.13 [Nov-27-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= gi|70879148|gb|EAN92345.1| hypothetical protein, conserved
[Trypanosoma cruzi]
         (386 letters)

Database: S.arctica/genome.fa 
           15,618 sequences; 121,588,341 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

supercont1.774 of Sphaeroforma arctica JP610                           30   8.3  

>supercont1.774 of Sphaeroforma arctica JP610
          Length = 43775

 Score = 30.4 bits (67), Expect = 8.3
 Identities = 16/41 (39%), Positives = 20/41 (48%), Gaps = 2/41 (4%)
 Frame = -2

Query: 71   FSPEAWRRACDEVREATFQRIRQCLLNPEKKRGR--NMSST 109
            +SP  WRR C  +  A  Q  + CL   E KR    N+ ST
Sbjct: 4429 YSPPPWRRICTRLHRAGGQSRKPCLCGTEGKRHALDNLDST 4307


  Database: S.arctica/genome.fa
    Posted date:  Nov 21, 2011  7:47 PM
  Number of letters in database: 121,588,341
  Number of sequences in database:  15,618
  
Lambda     K      H
   0.319    0.133    0.400 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Hits to DB: 53,159,698
Number of Sequences: 15618
Number of extensions: 760248
Number of successful extensions: 3293
Number of sequences better than 10.0: 1
Number of HSP's better than 10.0 without gapping: 929
Number of HSP's successfully gapped in prelim test: 153
Number of HSP's that attempted gapping in prelim test: 2063
Number of HSP's gapped (non-prelim): 1804
length of query: 386
length of database: 40,529,447
effective HSP length: 111
effective length of query: 275
effective length of database: 38,795,849
effective search space: 10668858475
effective search space used: 10668858475
frameshift window, decay const: 40,  0.1
T: 13
A: 40
X1: 16 ( 7.4 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.8 bits)
S2: 66 (30.0 bits)