TBLASTN 2.2.13 [Nov-27-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= gi|70879148|gb|EAN92345.1| hypothetical protein, conserved [Trypanosoma cruzi] (386 letters) Database: P.polycephalum/genome.fa 297,657 sequences; 319,018,052 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Contig8624 4696 7507 33 2.3 Contig6085 7388 7787 32 6.8 >Contig8624 4696 7507 Length = 7507 Score = 33.1 bits (74), Expect = 2.3 Identities = 21/74 (28%), Positives = 36/74 (48%), Gaps = 4/74 (5%) Frame = +3 Query: 23 IQRLSEQVTTEGERSNS----RHGGVVEAVLELDTFISSYEERDGTQRNGSNFSPEAWRR 78 ++R++E++ G R N R+ G E E + + ER+GT+RNG+ R+ Sbjct: 4386 LRRMAEEINLGGRRRNGSRAERNDGTTEREAERNGTERNGTERNGTERNGTERKRRGGRK 4565 Query: 79 ACDEVREATFQRIR 92 E R+ +R R Sbjct: 4566 GRKEKRKRQRKRKR 4607 >Contig6085 7388 7787 Length = 7787 Score = 31.6 bits (70), Expect = 6.8 Identities = 15/43 (34%), Positives = 23/43 (53%) Frame = -1 Query: 1 MRICLVLLSGLPGAGKTTLSLAIQRLSEQVTTEGERSNSRHGG 43 + +CL L G+P G + S + + L E + GE+S R GG Sbjct: 6272 LSLCL*GLKGVPAFGTNSTSWSCKFLLESIKGRGEKSKGRRGG 6144 Database: P.polycephalum/genome.fa Posted date: Nov 21, 2011 7:46 PM Number of letters in database: 319,018,052 Number of sequences in database: 297,657 Lambda K H 0.319 0.133 0.400 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 145,184,639 Number of Sequences: 297657 Number of extensions: 2100500 Number of successful extensions: 10418 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 9866 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 10401 length of query: 386 length of database: 106,339,350 effective HSP length: 115 effective length of query: 271 effective length of database: 72,108,795 effective search space: 19541483445 effective search space used: 19541483445 frameshift window, decay const: 40, 0.1 T: 13 A: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 69 (31.2 bits)