TBLASTN 2.2.13 [Nov-27-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= gi|70879148|gb|EAN92345.1| hypothetical protein, conserved [Trypanosoma cruzi] (386 letters) Database: D.discoideum_AX4/genome.fa 6 sequences; 33,943,072 total letters Searching......done Score E Sequences producing significant alignments: (bits) Value gi|93569069|gb|CM000154.2| Dictyostelium discoideum AX4 chromoso... 31 1.9 gi|256541943|gb|CM000151.3| Dictyostelium discoideum AX4 chromos... 29 7.2 >gi|93569069|gb|CM000154.2| Dictyostelium discoideum AX4 chromosome 5, whole genome shotgun sequence Length = 5125352 Score = 30.8 bits (68), Expect = 1.9 Identities = 19/57 (33%), Positives = 29/57 (50%) Frame = -3 Query: 5 LVLLSGLPGAGKTTLSLAIQRLSEQVTTEGERSNSRHGGVVEAVLELDTFISSYEER 61 ++LL G+PGAGK+ L + + EGE + H V E + DT S ++R Sbjct: 288366 MILLMGIPGAGKSLLLKVLGNRLGKGKIEGELKFNNH-EVDETTHQRDTIFVSQDDR 288199 >gi|256541943|gb|CM000151.3| Dictyostelium discoideum AX4 chromosome 2, whole genome shotgun sequence Length = 8484197 Score = 28.9 bits (63), Expect = 7.2 Identities = 12/25 (48%), Positives = 17/25 (68%) Frame = -1 Query: 5 LVLLSGLPGAGKTTLSLAIQRLSEQ 29 + ++ G PG+GKTTLS I + S Q Sbjct: 5470799 VTIIEGQPGSGKTTLSFLISKFSIQ 5470725 Database: D.discoideum_AX4/genome.fa Posted date: Nov 21, 2011 7:46 PM Number of letters in database: 33,943,072 Number of sequences in database: 6 Lambda K H 0.319 0.133 0.400 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 10,343,243 Number of Sequences: 6 Number of extensions: 118512 Number of successful extensions: 429 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 1 Number of HSP's successfully gapped in prelim test: 1 Number of HSP's that attempted gapping in prelim test: 402 Number of HSP's gapped (non-prelim): 131 length of query: 386 length of database: 11,314,357 effective HSP length: 103 effective length of query: 283 effective length of database: 11,313,739 effective search space: 3201788137 effective search space used: 3201788137 frameshift window, decay const: 40, 0.1 T: 13 A: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 62 (28.5 bits)