TBLASTN 2.2.13 [Nov-27-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= gi|66814240|ref|XP_641299.1| O-phosphoseryl-tRNA selenium transferase [Dictyostelium discoideum AX4] (479 letters) Database: A.rara/genome.fa 3231 sequences; 1,450,095 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gi|330848154|gb|ADNL01002449.1| Astrammina rara contig02914, who... 27 1.1 gi|330850330|gb|ADNL01000273.1| Astrammina rara contig00284, who... 25 2.4 gi|330850160|gb|ADNL01000443.1| Astrammina rara contig00488, who... 25 3.1 gi|330849622|gb|ADNL01000981.1| Astrammina rara contig01143, who... 25 4.0 gi|330850591|gb|ADNL01000012.1| Astrammina rara contig00013, who... 24 5.2 gi|330849708|gb|ADNL01000895.1| Astrammina rara contig01040, who... 24 6.8 gi|330850300|gb|ADNL01000303.1| Astrammina rara contig00314, who... 24 6.8 gi|330847439|gb|ADNL01003164.1| Astrammina rara contig02816, who... 23 8.9 >gi|330848154|gb|ADNL01002449.1| Astrammina rara contig02914, whole genome shotgun sequence Length = 13323 Score = 26.6 bits (57), Expect = 1.1 Identities = 15/37 (40%), Positives = 19/37 (51%) Frame = +3 Query: 219 NILCVFSTTSCFAPRVPDKIIEISEICKRYNIGHIIN 255 N LC+F+T S PRV I + R NIG I + Sbjct: 12234 NRLCLFATKSVHNPRVFASGFFILSLINRVNIGAIFS 12344 >gi|330850330|gb|ADNL01000273.1| Astrammina rara contig00284, whole genome shotgun sequence Length = 605 Score = 25.4 bits (54), Expect = 2.4 Identities = 10/27 (37%), Positives = 14/27 (51%) Frame = -3 Query: 227 TSCFAPRVPDKIIEISEICKRYNIGHI 253 TSC RV E+ E+C+ Y H+ Sbjct: 453 TSCMRGRVTVGRFEVEELCREYGSFHV 373 >gi|330850160|gb|ADNL01000443.1| Astrammina rara contig00488, whole genome shotgun sequence Length = 753 Score = 25.0 bits (53), Expect = 3.1 Identities = 13/39 (33%), Positives = 19/39 (48%) Frame = -1 Query: 407 IGSKLFSRSCSGSRVIDLKSNKKLLIGGLEFNNYGSHID 445 + S FS S + DL N+ IGG+ N +H+D Sbjct: 705 VKSDTFSPSDLAMAIEDLMKNETFEIGGIGLYNTFTHVD 589 >gi|330849622|gb|ADNL01000981.1| Astrammina rara contig01143, whole genome shotgun sequence Length = 240 Score = 24.6 bits (52), Expect = 4.0 Identities = 9/15 (60%), Positives = 11/15 (73%) Frame = +3 Query: 169 LWPRIDQKSCLKSII 183 LWP I+ SCLKS + Sbjct: 180 LWPTIEALSCLKSAV 224 >gi|330850591|gb|ADNL01000012.1| Astrammina rara contig00013, whole genome shotgun sequence Length = 4866 Score = 24.3 bits (51), Expect = 5.2 Identities = 13/25 (52%), Positives = 16/25 (64%) Frame = +3 Query: 424 LKSNKKLLIGGLEFNNYGSHIDNYS 448 LKSNK L L FNN+ +H NY+ Sbjct: 3072 LKSNKNLTKSTLYFNNH-NHRHNYN 3143 >gi|330849708|gb|ADNL01000895.1| Astrammina rara contig01040, whole genome shotgun sequence Length = 242 Score = 23.9 bits (50), Expect = 6.8 Identities = 10/27 (37%), Positives = 16/27 (59%) Frame = -3 Query: 246 KRYNIGHIINNAYGLQCSKILHNISQA 272 ++YNI +IINN + L IL + + Sbjct: 216 RKYNIFYIINNRFTLSIYSILFKFTNS 136 >gi|330850300|gb|ADNL01000303.1| Astrammina rara contig00314, whole genome shotgun sequence Length = 1296 Score = 23.9 bits (50), Expect = 6.8 Identities = 11/33 (33%), Positives = 20/33 (60%) Frame = -2 Query: 190 IVIPNQLDGDMIRTDLVAIEDKIKELGVDNILC 222 ++I + GD++ + AI K K+L +D +LC Sbjct: 1247 LIIIAGIGGDLMIEFIEAIYKKHKDLNIDFLLC 1149 >gi|330847439|gb|ADNL01003164.1| Astrammina rara contig02816, whole genome shotgun sequence Length = 531 Score = 23.5 bits (49), Expect = 8.9 Identities = 9/18 (50%), Positives = 13/18 (72%) Frame = -2 Query: 356 SKFALENNEKLLNTINEN 373 S+ ENN +LNTI+E+ Sbjct: 491 SRATFENNSSILNTIHES 438 Database: A.rara/genome.fa Posted date: Nov 21, 2011 7:46 PM Number of letters in database: 1,450,095 Number of sequences in database: 3231 Lambda K H 0.319 0.137 0.392 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 672,747 Number of Sequences: 3231 Number of extensions: 8080 Number of successful extensions: 37 Number of sequences better than 10.0: 9 Number of HSP's better than 10.0 without gapping: 37 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 37 length of query: 479 length of database: 483,365 effective HSP length: 77 effective length of query: 402 effective length of database: 234,578 effective search space: 94300356 effective search space used: 94300356 frameshift window, decay const: 40, 0.1 T: 13 A: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 49 (23.5 bits)