TBLASTN 2.2.13 [Nov-27-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= SPP00000106_1.0 # Protein # SECIS binding protein 2 (SBP2) #
Mus musculus # Complete
         (858 letters)

Database: genome.fa 
           697 sequences; 71,881,135 total letters

Searching.....................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

scaffold_112                                                           31   8.1  

>scaffold_112
          Length = 297279

 Score = 31.2 bits (69), Expect = 8.1
 Identities = 18/63 (28%), Positives = 35/63 (55%), Gaps = 2/63 (3%)
 Frame = -3

Query: 711    GLDDTLHTIIDCACEQNIPFVFALNRKALGRSLN-KAVP-VSIVGIFSYDGAQDQFHKMV 768
              G D  +  ++     +NIP +FA  R  LGR+ + K  P +S++ + +Y   ++ F K++
Sbjct: 164458 GPDHQILKVLKECFNKNIPVIFASTRSKLGRAFSGKFGPKISVISVINY*NMEE*FTKLI 164279

Query: 769    ELT 771
               L+
Sbjct: 164278 *LS 164270


  Database: genome.fa
    Posted date:  Feb 10, 2010 10:01 AM
  Number of letters in database: 71,881,135
  Number of sequences in database:  697
  
Lambda     K      H
   0.311    0.126    0.360 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Hits to DB: 42,349,816
Number of Sequences: 697
Number of extensions: 444131
Number of successful extensions: 988
Number of sequences better than 10.0: 1
Number of HSP's better than 10.0 without gapping: 6
Number of HSP's successfully gapped in prelim test: 11
Number of HSP's that attempted gapping in prelim test: 951
Number of HSP's gapped (non-prelim): 104
length of query: 858
length of database: 23,960,378
effective HSP length: 115
effective length of query: 743
effective length of database: 23,880,223
effective search space: 17743005689
effective search space used: 17743005689
frameshift window, decay const: 40,  0.1
T: 13
A: 40
X1: 16 ( 7.2 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 42 (21.8 bits)
S2: 68 (30.8 bits)