TBLASTN 2.2.13 [Nov-27-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= SPP00000037_1.0 # Protein # SECIS binding protein 2 (SBP2) # Homo sapiens # Complete (854 letters) Database: genome.fa 9 sequences; 8,347,606 total letters Searching.........done Score E Sequences producing significant alignments: (bits) Value gb|AAGK01000006.1| Theileria parva strain Muguga chromosome 3 ct... 32 0.73 gb|AAGK01000002.1| Theileria parva strain Muguga chromosome 2 ch... 30 1.6 gb|AAGK01000004.1| Theileria parva strain Muguga chromosome 4 ct... 29 3.6 gb|AAGK01000001.1| Theileria parva strain Muguga chromosome 1 ch... 28 6.2 >gb|AAGK01000006.1| Theileria parva strain Muguga chromosome 3 ctg_531, whole genome shotgun sequence Length = 570487 Score = 31.6 bits (70), Expect = 0.73 Identities = 23/84 (27%), Positives = 37/84 (44%) Frame = +1 Query: 513 PLMKKGKQREIPKAKKPTSLKKIILKERQERKQRLQENAVSPAFTSDDTQDGESGGDDQF 572 P+ KK ++RE + KK K+ +QE RL + + + D+ Sbjct: 188710 PVKKKTERRESVREKKAEIAAKLDKSIQQELLNRLSQGIYGELYNFEK---------DKV 188862 Query: 573 PEQAELSGPEGMDELISTPSVEDK 596 PE+ E S P+ +DE P V+ K Sbjct: 188863 PEKEEESEPDMLDETKLEPLVKRK 188934 >gb|AAGK01000002.1| Theileria parva strain Muguga chromosome 2 chr2_complete, whole genome shotgun sequence Length = 1971884 Score = 30.4 bits (67), Expect = 1.6 Identities = 22/100 (22%), Positives = 40/100 (40%), Gaps = 11/100 (11%) Frame = -3 Query: 526 AKKPTSLKKIILKERQERKQRLQENAVSPAFTSDDTQDG-----------ESGGDDQFPE 574 + +P+ KK+ + R + Q P+ SD E G DD+ PE Sbjct: 21138 SSEPSKTKKLKHSYKHNRPTKSQATGEQPSQPSDQNPQPNEPLEPEHIPVEVGSDDEEPE 20959 Query: 575 QAELSGPEGMDELISTPSVEDKSEEPPGTELQRDTEASHL 614 + + G EG + ED+ +E P +++ E + + Sbjct: 20958 EGAVGGAEGGE--------EDEEDERPSEPVKKCKEITFM 20863 Score = 28.9 bits (63), Expect = 4.7 Identities = 11/27 (40%), Positives = 14/27 (51%) Frame = -1 Query: 90 YAYSPYTLDSTQNVYSVPGSQYLYNQP 116 Y Y YTL +T +Y P Y+ N P Sbjct: 1252625 YMYHSYTLHNTHYIYYTPRGSYIINTP 1252545 Score = 28.9 bits (63), Expect = 4.7 Identities = 21/88 (23%), Positives = 40/88 (45%), Gaps = 3/88 (3%) Frame = +1 Query: 497 RMSQMKTPHNPLDSSAPLMKKGKQREIPKAKKPTSLKKIILKERQERKQRLQENAVSPAF 556 R +K PH + P + + E K KP+ + +++ + +R+ S Sbjct: 1965028 REQPIKIPHTKHQTERPTKSQPTKPEPSKPTKPSEPTEPSGTDKELQPERIPVEVGS--- 1965198 Query: 557 TSDDTQDGESGG---DDQFPEQAELSGP 581 D+T++G +GG DD+ E+ + S P Sbjct: 1965199 -DDETEEGAAGGGDDDDEGDEKVKPSEP 1965279 >gb|AAGK01000004.1| Theileria parva strain Muguga chromosome 4 ctg_529, whole genome shotgun sequence Length = 1835834 Score = 29.3 bits (64), Expect = 3.6 Identities = 13/34 (38%), Positives = 21/34 (61%) Frame = -2 Query: 722 NIPFVFALNRKALGRSLNKAVPVSVVGIFSYDGA 755 N+P++F ++ ALGR+ + PV I S DG+ Sbjct: 1750393 NVPYIFVHSKVALGRACGVSRPVISCAITSRDGS 1750292 >gb|AAGK01000001.1| Theileria parva strain Muguga chromosome 1 chr1_complete, whole genome shotgun sequence Length = 2540030 Score = 28.5 bits (62), Expect = 6.2 Identities = 14/37 (37%), Positives = 20/37 (54%) Frame = +3 Query: 72 GASTFPPQYLSSEITLHPYAYSPYTLDSTQNVYSVPG 108 G++ PPQ SS L Y+ YTLD + +Y + G Sbjct: 1044786 GSTKLPPQEHSSHNLLSTILYTIYTLDVVRILYIIDG 1044896 Database: genome.fa Posted date: Jan 19, 2010 5:27 PM Number of letters in database: 8,347,606 Number of sequences in database: 9 Lambda K H 0.311 0.128 0.365 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 5,985,418 Number of Sequences: 9 Number of extensions: 74722 Number of successful extensions: 318 Number of sequences better than 10.0: 4 Number of HSP's better than 10.0 without gapping: 3 Number of HSP's successfully gapped in prelim test: 3 Number of HSP's that attempted gapping in prelim test: 253 Number of HSP's gapped (non-prelim): 155 length of query: 854 length of database: 2,782,535 effective HSP length: 100 effective length of query: 754 effective length of database: 2,781,635 effective search space: 2097352790 effective search space used: 2097352790 frameshift window, decay const: 40, 0.1 T: 13 A: 40 X1: 16 ( 7.2 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 42 (21.8 bits) S2: 60 (27.7 bits)