TBLASTN 2.2.13 [Nov-27-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= SPP00000087_1.0 # Protein # SECIS binding protein 2 (SBP2) # Drosophila melanogaster # Complete (313 letters) Database: genome.fa 5578 sequences; 78,051,097 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|AAQY01000810.1| Phytophthora sojae strain P6497 Psojae_Cont81... 64 3e-10 gb|AAQY01000370.1| Phytophthora sojae strain P6497 Psojae_Cont37... 32 1.1 gb|AAQY01000255.1| Phytophthora sojae strain P6497 Psojae_Cont25... 32 1.1 gb|AAQY01004293.1| Phytophthora sojae strain P6497 Psojae_Cont42... 31 2.4 gb|AAQY01001585.1| Phytophthora sojae strain P6497 Psojae_Cont15... 31 3.1 gb|AAQY01000178.1| Phytophthora sojae strain P6497 Psojae_Cont17... 30 4.1 gb|AAQY01004299.1| Phytophthora sojae strain P6497 Psojae_Cont42... 30 5.3 gb|AAQY01001363.1| Phytophthora sojae strain P6497 Psojae_Cont13... 30 5.3 gb|AAQY01001140.1| Phytophthora sojae strain P6497 Psojae_Cont11... 30 5.3 gb|AAQY01000715.1| Phytophthora sojae strain P6497 Psojae_Cont71... 30 5.3 gb|AAQY01000712.1| Phytophthora sojae strain P6497 Psojae_Cont71... 30 5.3 gb|AAQY01001353.1| Phytophthora sojae strain P6497 Psojae_Cont13... 29 9.1 gb|AAQY01000381.1| Phytophthora sojae strain P6497 Psojae_Cont38... 29 9.1 >gb|AAQY01000810.1| Phytophthora sojae strain P6497 Psojae_Cont810, whole genome shotgun sequence Length = 104728 Score = 64.3 bits (155), Expect = 3e-10 Identities = 38/111 (34%), Positives = 59/111 (53%) Frame = -1 Query: 190 QKRAFAKNEIKARAHPRLVLGVREALARLRINKVKLLFLATDCEICPGESGLDATIEGLK 249 Q+RA + N + + RLVLG+ E L K++LL +ATD E C + A I + Sbjct: 103912 QERAHSLNPKQDKRSRRLVLGLHEVRRGLLNKKIRLLVIATDLEGCEAVAQEIAEIVAI- 103736 Query: 250 FQCQQQQVPYCFPLLRRELSYALQKRAQICCVAILDFDGANATYADLLNEI 300 +Q+VP P+ RR+L LQK+ ++ CV + DGAN + +L + Sbjct: 103735 --AAEQEVPMLSPMNRRKLGRTLQKKVRVSCVGVYSVDGANDLFQKILRSM 103589 >gb|AAQY01000370.1| Phytophthora sojae strain P6497 Psojae_Cont370, whole genome shotgun sequence Length = 138508 Score = 32.3 bits (72), Expect = 1.1 Identities = 14/44 (31%), Positives = 22/44 (50%) Frame = +1 Query: 122 QDINPNAIPLEQQVQNLSLSKTPAPNNPSQAKTVHAIHSRRFRS 165 Q + P A PL Q ++ ++ P P NPS T H++ + S Sbjct: 97042 QQMQPAAAPLSQLLRTSRIAPPPTPPNPSAEHTAHSVDKNQSMS 97173 >gb|AAQY01000255.1| Phytophthora sojae strain P6497 Psojae_Cont255, whole genome shotgun sequence Length = 22552 Score = 32.3 bits (72), Expect = 1.1 Identities = 19/63 (30%), Positives = 29/63 (46%), Gaps = 4/63 (6%) Frame = -3 Query: 118 PVVGQDINPNAIPLEQQVQNLSLSKTPAPNNPSQAKTVHA----IHSRRFRSYCDNCTRP 173 P G NP+A P +Q Q L + + PAP PS + R+ + C+ C + Sbjct: 2309 PGCGWTYNPSAHPWQQLQQYLLVLRPPAPRYPSLQEPTEGPADWTREDRYCTACERCVQR 2130 Query: 174 RLK 176 +LK Sbjct: 2129 QLK 2121 >gb|AAQY01004293.1| Phytophthora sojae strain P6497 Psojae_Cont4293, whole genome shotgun sequence Length = 2070 Score = 31.2 bits (69), Expect = 2.4 Identities = 19/56 (33%), Positives = 29/56 (51%), Gaps = 6/56 (10%) Frame = -3 Query: 138 LSLSKTPAPNNPSQAKTVHAIHSRRFRS------YCDNCTRPRLKELSTQLLRDLD 187 + LSKTP+P + + + A + +RS Y CTRP + + TQL R L+ Sbjct: 1777 MKLSKTPSPTTQKEREEMQA---KSYRSLIGCLLYITTCTRPDVAYIVTQLSRFLE 1619 >gb|AAQY01001585.1| Phytophthora sojae strain P6497 Psojae_Cont1585, whole genome shotgun sequence Length = 233777 Score = 30.8 bits (68), Expect = 3.1 Identities = 18/53 (33%), Positives = 26/53 (49%), Gaps = 3/53 (5%) Frame = -1 Query: 138 LSLSKTPAPNNPSQAKTVHAIHSRRFRS---YCDNCTRPRLKELSTQLLRDLD 187 + LSKTP+P + + + A R Y CTRP + + TQL R L+ Sbjct: 85838 MKLSKTPSPTTQKEREEMQAKSYRALIGCLLYITTCTRPDVAYIVTQLSRFLE 85680 >gb|AAQY01000178.1| Phytophthora sojae strain P6497 Psojae_Cont178, whole genome shotgun sequence Length = 110386 Score = 30.4 bits (67), Expect = 4.1 Identities = 14/42 (33%), Positives = 27/42 (64%) Frame = -2 Query: 22 PRSSKYKNQHRKREQQTSLLDFVIKPRPKTQRQTKAHKLQKT 63 P+S K K +H+K++++ + + KP+ K ++ K HK +KT Sbjct: 7434 PKSKKDKKKHKKQKREEA-AEEEEKPKEKKDKKDKKHKKKKT 7312 >gb|AAQY01004299.1| Phytophthora sojae strain P6497 Psojae_Cont4299, whole genome shotgun sequence Length = 5137 Score = 30.0 bits (66), Expect = 5.3 Identities = 25/111 (22%), Positives = 52/111 (46%), Gaps = 4/111 (3%) Frame = +2 Query: 48 RPKTQRQTKAHKLQKTHLAITRGSYIVYKPKGKTRLDPKKKITRLKKSVRVYRTSKKAE- 106 +PKT TKA K T ++ +G + +P G P +++ + + + + K A Sbjct: 4583 KPKTSEVTKAVKKVLTAASMLQGLGGILQPVGPAAF-PAERVNAILQVLEQQKRRKLAPV 4759 Query: 107 ---REVAENDLEGVPVVGQDINPNAIPLEQQVQNLSLSKTPAPNNPSQAKT 154 E E + + ++++ + LEQ+ + +TPAP +P+++ T Sbjct: 4760 VQWDEATRRTNEMLAMWAEEVHM-LVHLEQESRKPQKPQTPAPASPAKSTT 4909 >gb|AAQY01001363.1| Phytophthora sojae strain P6497 Psojae_Cont1363, whole genome shotgun sequence Length = 127617 Score = 30.0 bits (66), Expect = 5.3 Identities = 23/68 (33%), Positives = 32/68 (47%), Gaps = 7/68 (10%) Frame = -2 Query: 127 NAIPLEQQ-VQNLSLSKTPAPNNPSQAKTVHAIHSRRFRS------YCDNCTRPRLKELS 179 NA P++ L L+KT +P + I SR +RS Y CTRP + + Sbjct: 119774 NAKPVDNPCTSGLKLTKTQSPGTDEERTE---IKSRPYRSLIGCLLYITTCTRPDIAYVV 119604 Query: 180 TQLLRDLD 187 TQL R L+ Sbjct: 119603 TQLSRFLE 119580 >gb|AAQY01001140.1| Phytophthora sojae strain P6497 Psojae_Cont1140, whole genome shotgun sequence Length = 266696 Score = 30.0 bits (66), Expect = 5.3 Identities = 18/53 (33%), Positives = 26/53 (49%), Gaps = 3/53 (5%) Frame = +1 Query: 138 LSLSKTPAPNNPSQAKTVHAIHSRRFRS---YCDNCTRPRLKELSTQLLRDLD 187 L LSKT +P + + + A+ R Y CTRP + + TQL R L+ Sbjct: 105397 LKLSKTQSPTTQKEREEMQAMTYRALIGRLLYITTCTRPDVAYIMTQLSRFLE 105555 >gb|AAQY01000715.1| Phytophthora sojae strain P6497 Psojae_Cont715, whole genome shotgun sequence Length = 5006 Score = 30.0 bits (66), Expect = 5.3 Identities = 25/111 (22%), Positives = 52/111 (46%), Gaps = 4/111 (3%) Frame = -3 Query: 48 RPKTQRQTKAHKLQKTHLAITRGSYIVYKPKGKTRLDPKKKITRLKKSVRVYRTSKKAE- 106 +PKT TKA K T ++ +G + +P G P +++ + + + + K A Sbjct: 984 KPKTSEVTKAVKKVLTAASMLQGLGGILQPVGPAAF-PAERVNAILQVLEQQKRRKLAPV 808 Query: 107 ---REVAENDLEGVPVVGQDINPNAIPLEQQVQNLSLSKTPAPNNPSQAKT 154 E E + + ++++ + LEQ+ + +TPAP +P+++ T Sbjct: 807 VQWDEATRRTNEMLAMWAEEVHM-LVHLEQESRKPQKPQTPAPASPAKSTT 658 >gb|AAQY01000712.1| Phytophthora sojae strain P6497 Psojae_Cont712, whole genome shotgun sequence Length = 160322 Score = 30.0 bits (66), Expect = 5.3 Identities = 25/111 (22%), Positives = 52/111 (46%), Gaps = 4/111 (3%) Frame = +2 Query: 48 RPKTQRQTKAHKLQKTHLAITRGSYIVYKPKGKTRLDPKKKITRLKKSVRVYRTSKKAE- 106 +PKT TKA K T ++ +G + +P G P +++ + + + + K A Sbjct: 153503 KPKTSEVTKAVKKVLTAASMLQGLGGILQPVGPAAF-PAERVNAILQVLEQQKRRKLAPV 153679 Query: 107 ---REVAENDLEGVPVVGQDINPNAIPLEQQVQNLSLSKTPAPNNPSQAKT 154 E E + + ++++ + LEQ+ + +TPAP +P+++ T Sbjct: 153680 VQWDEATRRTNEMLAMWAEEVHM-LVHLEQESRKPQKPQTPAPASPAKSTT 153829 >gb|AAQY01001353.1| Phytophthora sojae strain P6497 Psojae_Cont1353, whole genome shotgun sequence Length = 54019 Score = 29.3 bits (64), Expect = 9.1 Identities = 16/42 (38%), Positives = 18/42 (42%) Frame = +3 Query: 132 EQQVQNLSLSKTPAPNNPSQAKTVHAIHSRRFRSYCDNCTRP 173 E Q QNL K P S T H +H RR + C RP Sbjct: 49026 EHQNQNLRTPKNGTP--ASMQVTAHLLHVRRVAACASQCVRP 49145 >gb|AAQY01000381.1| Phytophthora sojae strain P6497 Psojae_Cont381, whole genome shotgun sequence Length = 36355 Score = 29.3 bits (64), Expect = 9.1 Identities = 19/58 (32%), Positives = 24/58 (41%) Frame = +2 Query: 207 LVLGVREALARLRINKVKLLFLATDCEICPGESGLDATIEGLKFQCQQQQVPYCFPLL 264 L LGVR+ +R CE S AT L+F C+ QQ C PL+ Sbjct: 20513 LTLGVRKVYGLVRSGTGTGYLKLRLCESVTSSSDAKATAAPLQFWCRGQQTRSCPPLI 20686 Database: genome.fa Posted date: Jan 19, 2010 5:09 PM Number of letters in database: 78,051,097 Number of sequences in database: 5578 Lambda K H 0.319 0.132 0.377 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 27,793,599 Number of Sequences: 5578 Number of extensions: 419851 Number of successful extensions: 2856 Number of sequences better than 10.0: 13 Number of HSP's better than 10.0 without gapping: 706 Number of HSP's successfully gapped in prelim test: 202 Number of HSP's that attempted gapping in prelim test: 1631 Number of HSP's gapped (non-prelim): 1882 length of query: 313 length of database: 26,017,032 effective HSP length: 106 effective length of query: 207 effective length of database: 25,425,764 effective search space: 5263133148 effective search space used: 5263133148 frameshift window, decay const: 40, 0.1 T: 13 A: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 64 (29.3 bits)