TBLASTN 2.2.13 [Nov-27-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= gi|70879148|gb|EAN92345.1| hypothetical protein, conserved
[Trypanosoma cruzi]
         (386 letters)

Database: genome.fa 
           2172 sequences; 20,771,095 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

gb|AAFB02000236.1| Entamoeba histolytica HM-1:IMSS gcontig_11047...    29   3.3  

>gb|AAFB02000236.1| Entamoeba histolytica HM-1:IMSS gcontig_1104750505009, whole genome
             shotgun sequence
          Length = 24989

 Score = 29.3 bits (64), Expect = 3.3
 Identities = 18/60 (30%), Positives = 32/60 (53%)
 Frame = -2

Query: 6     VLLSGLPGAGKTTLSLAIQRLSEQVTTEGERSNSRHGGVVEAVLELDTFISSYEERDGTQ 65
             VLL+G PG GKTT+S  + +       E   S++R+   +E  ++   F++     DG++
Sbjct: 14530 VLLAGAPGVGKTTVSKIVGKTLGFNPIEFNASDTRNKSSIELAIK-RIFLNGQISIDGSK 14354


  Database: genome.fa
    Posted date:  Jan 19, 2010  5:04 PM
  Number of letters in database: 20,771,095
  Number of sequences in database:  2172
  
Lambda     K      H
   0.319    0.133    0.400 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Hits to DB: 6,482,652
Number of Sequences: 2172
Number of extensions: 75113
Number of successful extensions: 255
Number of sequences better than 10.0: 1
Number of HSP's better than 10.0 without gapping: 72
Number of HSP's successfully gapped in prelim test: 14
Number of HSP's that attempted gapping in prelim test: 178
Number of HSP's gapped (non-prelim): 100
length of query: 386
length of database: 6,923,698
effective HSP length: 99
effective length of query: 287
effective length of database: 6,708,670
effective search space: 1925388290
effective search space used: 1925388290
frameshift window, decay const: 40,  0.1
T: 13
A: 40
X1: 16 ( 7.4 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.8 bits)
S2: 60 (27.7 bits)