TBLASTN 2.2.13 [Nov-27-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= gi|70879148|gb|EAN92345.1| hypothetical protein, conserved [Trypanosoma cruzi] (386 letters) Database: genome.fa 799 sequences; 32,967,507 total letters Searching.....................................................done Score E Sequences producing significant alignments: (bits) Value scaffold_22 30 2.4 scaffold_131 29 5.4 >scaffold_22 Length = 145158 Score = 30.4 bits (67), Expect = 2.4 Identities = 17/45 (37%), Positives = 26/45 (57%) Frame = +3 Query: 6 VLLSGLPGAGKTTLSLAIQRLSEQVTTEGERSNSRHGGVVEAVLE 50 VLLSG PG GKT+ ++ + +L E S++R +E VL+ Sbjct: 67605 VLLSGPPGIGKTSAAILLCKLKGFEPIELNASDTRSKSEIERVLK 67739 >scaffold_131 Length = 73580 Score = 29.3 bits (64), Expect = 5.4 Identities = 18/57 (31%), Positives = 30/57 (52%) Frame = +1 Query: 5 LVLLSGLPGAGKTTLSLAIQRLSEQVTTEGERSNSRHGGVVEAVLELDTFISSYEER 61 +VLL G+PG+GK+ L + + + EGE +RH + + DT S ++R Sbjct: 63661 MVLLMGIPGSGKSVLLKTLGNRLGKGSIEGELLFNRH-PCAPSTHQRDTIYVSQDDR 63828 Database: genome.fa Posted date: Jan 16, 2009 12:50 PM Number of letters in database: 32,967,507 Number of sequences in database: 799 Lambda K H 0.319 0.133 0.400 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 10,531,120 Number of Sequences: 799 Number of extensions: 124943 Number of successful extensions: 439 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 35 Number of HSP's successfully gapped in prelim test: 12 Number of HSP's that attempted gapping in prelim test: 395 Number of HSP's gapped (non-prelim): 83 length of query: 386 length of database: 10,989,169 effective HSP length: 102 effective length of query: 284 effective length of database: 10,907,671 effective search space: 3097778564 effective search space used: 3097778564 frameshift window, decay const: 40, 0.1 T: 13 A: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 62 (28.5 bits)