TBLASTN 2.2.13 [Nov-27-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= gi|66814240|ref|XP_641299.1| O-phosphoseryl-tRNA selenium transferase [Dictyostelium discoideum AX4] (479 letters) Database: genome.fa 2172 sequences; 20,771,095 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|AAFB02000366.1| Entamoeba histolytica HM-1:IMSS gcontig_11047... 29 4.4 gb|AAFB02000089.1| Entamoeba histolytica HM-1:IMSS gcontig_11047... 28 7.5 gb|AAFB02000008.1| Entamoeba histolytica HM-1:IMSS gcontig_11047... 28 7.5 gb|AAFB02000279.1| Entamoeba histolytica HM-1:IMSS gcontig_11047... 28 9.8 gb|AAFB02000227.1| Entamoeba histolytica HM-1:IMSS gcontig_11047... 28 9.8 gb|AAFB02000011.1| Entamoeba histolytica HM-1:IMSS gcontig_11047... 28 9.8 >gb|AAFB02000366.1| Entamoeba histolytica HM-1:IMSS gcontig_1104750512360, whole genome shotgun sequence Length = 16111 Score = 29.3 bits (64), Expect = 4.4 Identities = 15/38 (39%), Positives = 23/38 (60%) Frame = -3 Query: 338 LNLLKERKELLIYFNEQLSKFALENNEKLLNTINENKI 375 L LLK +KEL+ Y + + KF +ENN + N ++ I Sbjct: 12773 LELLKFKKELIEYHSSIIEKF-IENNNSINNKVSSGTI 12663 >gb|AAFB02000089.1| Entamoeba histolytica HM-1:IMSS gcontig_1104750504619, whole genome shotgun sequence Length = 46612 Score = 28.5 bits (62), Expect = 7.5 Identities = 18/56 (32%), Positives = 30/56 (53%) Frame = +2 Query: 4 KNLETCKGLIKGSYIDQAIQGTSQFNKLLETLLIHKKLPNIGYNDKIIELILNEIS 59 KN+ET ++ + D A S LL+ L I+ KLP++ + K + +I N +S Sbjct: 29876 KNIETHDAVLYKTIYDNANNKFSNIINLLQKLFINIKLPSL-LDSKNVSIIKNIVS 30040 >gb|AAFB02000008.1| Entamoeba histolytica HM-1:IMSS gcontig_1104750512822, whole genome shotgun sequence Length = 118116 Score = 28.5 bits (62), Expect = 7.5 Identities = 22/56 (39%), Positives = 31/56 (55%), Gaps = 4/56 (7%) Frame = +3 Query: 306 IDQISRNYPGRANSSPILDVFITLLSMGKQG-WLN---LLKERKELLIYFNEQLSK 357 IDQI++N+ + S + F +L QG WLN +KER E L FNE ++K Sbjct: 59754 IDQINKNF----SKSLQIKKFGVVLEGTDQGMWLNEIKTIKERNEALKNFNEFITK 59909 >gb|AAFB02000279.1| Entamoeba histolytica HM-1:IMSS gcontig_1104750512132, whole genome shotgun sequence Length = 21389 Score = 28.1 bits (61), Expect = 9.8 Identities = 21/86 (24%), Positives = 38/86 (44%), Gaps = 2/86 (2%) Frame = -2 Query: 14 KGSYIDQAIQGTSQFNKLLETLLIHKKL--PNIGYNDKIIELILNEISLMDSNNFIENIG 71 KGS + G++ ++T+ IH L GY +K +E+ L+ I Sbjct: 15448 KGSIEKAQVHGSNVLYSPVQTVNIHCTLFLTKNGYEEKGLEVSLHSI------------- 15308 Query: 72 VGEREGRIYSGLVEKRHYGFAHGIGR 97 G++ + G V+ HY +G+G+ Sbjct: 15307 -GKKGKELCKGYVDLAHYADLNGVGK 15233 >gb|AAFB02000227.1| Entamoeba histolytica HM-1:IMSS gcontig_1104750512904, whole genome shotgun sequence Length = 25440 Score = 28.1 bits (61), Expect = 9.8 Identities = 13/39 (33%), Positives = 22/39 (56%), Gaps = 6/39 (15%) Frame = +1 Query: 217 VDNILCVFSTTSCFAPRVPDKI------IEISEICKRYN 249 ++ ++C+F++ CF +KI I+IS IC YN Sbjct: 4219 INYVICIFNSKECFNRYYINKIFFSKYTIDISIICSHYN 4335 >gb|AAFB02000011.1| Entamoeba histolytica HM-1:IMSS gcontig_1104750512060, whole genome shotgun sequence Length = 107510 Score = 28.1 bits (61), Expect = 9.8 Identities = 11/25 (44%), Positives = 17/25 (68%) Frame = -2 Query: 59 SLMDSNNFIENIGVGEREGRIYSGL 83 +L NNFIE++ R+ +IY+GL Sbjct: 51091 ALTKDNNFIEHMSKNNRDNKIYNGL 51017 Database: genome.fa Posted date: Jan 19, 2010 5:04 PM Number of letters in database: 20,771,095 Number of sequences in database: 2172 Lambda K H 0.319 0.137 0.392 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 10,624,805 Number of Sequences: 2172 Number of extensions: 158771 Number of successful extensions: 743 Number of sequences better than 10.0: 6 Number of HSP's better than 10.0 without gapping: 197 Number of HSP's successfully gapped in prelim test: 47 Number of HSP's that attempted gapping in prelim test: 495 Number of HSP's gapped (non-prelim): 347 length of query: 479 length of database: 6,923,698 effective HSP length: 101 effective length of query: 378 effective length of database: 6,704,326 effective search space: 2534235228 effective search space used: 2534235228 frameshift window, decay const: 40, 0.1 T: 13 A: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 61 (28.1 bits)