TBLASTN 2.2.13 [Nov-27-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= SelQ_toxoplasma_gondii_gladyshev # QUERY
         (66 letters)

Database: /users/rg/didac/GENOMES/S.arctica/genome.fa 
           15,618 sequences; 121,588,341 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

supercont1.1371 of Sphaeroforma arctica JP610                          28   2.9  

>supercont1.1371 of Sphaeroforma arctica JP610
          Length = 16407

 Score = 28.5 bits (62), Expect = 2.9
 Identities = 15/39 (38%), Positives = 20/39 (51%)
 Frame = +3

Query: 28    HRRTWQFRGTIPQNPHLAPRFRPNVNDRYQIRRGRGGUC 66
             HRR +     +P   H  PRF P    RY +R+G+ G C
Sbjct: 14568 HRRRYPRPSPLPC--HTWPRFHP----RYHLRKGKSGIC 14666


  Database: /users/rg/didac/GENOMES/S.arctica/genome.fa
    Posted date:  Sep 29, 2011  6:14 PM
  Number of letters in database: 121,588,341
  Number of sequences in database:  15,618
  
Lambda     K      H
   0.326    0.143    0.484 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Hits to DB: 7,768,810
Number of Sequences: 15618
Number of extensions: 87688
Number of successful extensions: 638
Number of sequences better than 10.0: 2
Number of HSP's better than 10.0 without gapping: 608
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 638
length of query: 66
length of database: 40,529,447
effective HSP length: 41
effective length of query: 25
effective length of database: 39,889,109
effective search space: 997227725
effective search space used: 997227725
frameshift window, decay const: 40,  0.1
T: 13
A: 40
X1: 15 ( 7.1 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 40 (21.6 bits)
S2: 58 (26.9 bits)