TBLASTN 2.2.13 [Nov-27-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= SelQ_toxoplasma_gondii_gladyshev # QUERY (66 letters) Database: /users/rg/didac/GENOMES/A.rara/genome.fa 3231 sequences; 1,450,095 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|ADNL01000518.1| Astrammina rara contig00579, whole genome sho... 22 2.5 gb|ADNL01000044.1| Astrammina rara contig00047, whole genome sho... 22 2.5 gb|ADNL01000178.1| Astrammina rara contig00188, whole genome sho... 22 3.3 gb|ADNL01000170.1| Astrammina rara contig00177, whole genome sho... 22 3.3 gb|ADNL01000165.1| Astrammina rara contig00172, whole genome sho... 21 5.6 gb|ADNL01002603.1| Astrammina rara contig03080, whole genome sho... 20 9.6 >gb|ADNL01000518.1| Astrammina rara contig00579, whole genome shotgun sequence Length = 1533 Score = 22.3 bits (46), Expect = 2.5 Identities = 9/31 (29%), Positives = 16/31 (51%) Frame = +2 Query: 31 TWQFRGTIPQNPHLAPRFRPNVNDRYQIRRG 61 TW G++ +NP +P++ R + R G Sbjct: 170 TWMMEGSLGENPRPIKLLKPSILFRPKPRIG 262 >gb|ADNL01000044.1| Astrammina rara contig00047, whole genome shotgun sequence Length = 737 Score = 22.3 bits (46), Expect = 2.5 Identities = 13/33 (39%), Positives = 14/33 (42%) Frame = -3 Query: 30 RTWQFRGTIPQNPHLAPRFRPNVNDRYQIRRGR 62 R W F G PR R N DR+ RGR Sbjct: 516 RRWAFVGA-------DPRLRANSGDRHSKCRGR 439 >gb|ADNL01000178.1| Astrammina rara contig00188, whole genome shotgun sequence Length = 2971 Score = 21.9 bits (45), Expect = 3.3 Identities = 7/30 (23%), Positives = 15/30 (50%) Frame = -1 Query: 24 IQPEHRRTWQFRGTIPQNPHLAPRFRPNVN 53 ++ ++ W F T+ Q+P+L +N Sbjct: 2767 VEDRNQSWWTFTDTVEQSPNLEDHLNDLIN 2678 >gb|ADNL01000170.1| Astrammina rara contig00177, whole genome shotgun sequence Length = 1077 Score = 21.9 bits (45), Expect = 3.3 Identities = 7/14 (50%), Positives = 8/14 (57%) Frame = -2 Query: 20 RERGIQPEHRRTWQ 33 R G +P H R WQ Sbjct: 491 RRNGCRPVHHRVWQ 450 >gb|ADNL01000165.1| Astrammina rara contig00172, whole genome shotgun sequence Length = 222 Score = 21.2 bits (43), Expect = 5.6 Identities = 9/18 (50%), Positives = 11/18 (61%) Frame = -2 Query: 47 RFRPNVNDRYQIRRGRGG 64 +FRP RY+IRR G Sbjct: 101 KFRPYSGRRYRIRRCSSG 48 >gb|ADNL01002603.1| Astrammina rara contig03080, whole genome shotgun sequence Length = 8271 Score = 20.4 bits (41), Expect = 9.6 Identities = 8/19 (42%), Positives = 11/19 (57%) Frame = +1 Query: 26 PEHRRTWQFRGTIPQNPHL 44 P+H R + T+ Q PHL Sbjct: 7039 PKHVRVKLNKNTVCQTPHL 7095 Database: /users/rg/didac/GENOMES/A.rara/genome.fa Posted date: Sep 29, 2011 8:09 PM Number of letters in database: 1,450,095 Number of sequences in database: 3231 Lambda K H 0.326 0.143 0.484 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 90,171 Number of Sequences: 3231 Number of extensions: 885 Number of successful extensions: 8 Number of sequences better than 10.0: 6 Number of HSP's better than 10.0 without gapping: 8 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 8 length of query: 66 length of database: 483,365 effective HSP length: 34 effective length of query: 32 effective length of database: 373,511 effective search space: 11952352 effective search space used: 11952352 frameshift window, decay const: 40, 0.1 T: 13 A: 40 X1: 15 ( 7.1 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 40 (21.6 bits) S2: 41 (20.4 bits)