TBLASTN 2.2.13 [Nov-27-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= gi|166240590|ref|XP_643546.2| thyroxine 5'-deiodinase
[Dictyostelium discoideum AX4]
         (257 letters)

Database: C.fasciculata/genome.fa 
           1089 sequences; 37,048,325 total letters

Searching...................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

Cf_Contig876  |  | 1 to 197301                                         28   9.7  

>Cf_Contig876  |  | 1 to 197301
          Length = 197301

 Score = 27.7 bits (60), Expect = 9.7
 Identities = 19/53 (35%), Positives = 26/53 (49%), Gaps = 4/53 (7%)
 Frame = +3

Query: 58    SRERLNLQADTQCPDAILLDDQTNQEVSLYDLFNSNNNEKSVQ----DRPMVL 106
             SR RL ++  TQ   AILLD       SLY      +   ++Q    DRP++L
Sbjct: 12069 SRRRLPIEVSTQITKAILLDHYGGTSHSLYLFILIISFTSALQNLDKDRPLIL 12227


  Database: C.fasciculata/genome.fa
    Posted date:  Nov 21, 2011  7:46 PM
  Number of letters in database: 37,048,325
  Number of sequences in database:  1089
  
Lambda     K      H
   0.321    0.140    0.436 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Hits to DB: 11,076,907
Number of Sequences: 1089
Number of extensions: 137918
Number of successful extensions: 498
Number of sequences better than 10.0: 1
Number of HSP's better than 10.0 without gapping: 42
Number of HSP's successfully gapped in prelim test: 12
Number of HSP's that attempted gapping in prelim test: 439
Number of HSP's gapped (non-prelim): 105
length of query: 257
length of database: 12,349,441
effective HSP length: 99
effective length of query: 158
effective length of database: 12,241,630
effective search space: 1934177540
effective search space used: 1934177540
frameshift window, decay const: 40,  0.1
T: 13
A: 40
X1: 16 ( 7.4 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.8 bits)
S2: 60 (27.7 bits)