TBLASTN 2.2.13 [Nov-27-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= gi|29165348|gb|AAO65268.1| iodothyronine deiodinase type I Deio1 [Danio rerio] (241 letters) Database: T.congolense/genome.fa 11 sequences; 22,287,946 total letters Searching...........done Score E Sequences producing significant alignments: (bits) Value T.congo.pschr4 27 7.1 T.congo.pschr.5 27 9.3 T.congo.pschr.3. 27 9.3 >T.congo.pschr4 Length = 1343510 Score = 27.3 bits (59), Expect = 7.1 Identities = 11/27 (40%), Positives = 17/27 (62%) Frame = -3 Query: 108 RQKTSVHRFLKGNRPLVLSFGSCTUPP 134 R++ + RFL R ++LSF +C PP Sbjct: 368616 RKQQQLERFLVSRRAILLSFLACKVPP 368536 >T.congo.pschr.5 Length = 1517473 Score = 26.9 bits (58), Expect = 9.3 Identities = 17/47 (36%), Positives = 22/47 (46%), Gaps = 1/47 (2%) Frame = -1 Query: 69 PAFFSLAFIKTLFFVNWCSLGLEAFEGHAAPD-SALITLDRQKTSVH 114 P FFS +++ +NW SL F HAA S+ T RQ H Sbjct: 504211 PTFFSR*SVRSTALINWISLCRSYFFAHAARRLSSFSTCARQHEVEH 504071 >T.congo.pschr.3. Length = 1451265 Score = 26.9 bits (58), Expect = 9.3 Identities = 8/17 (47%), Positives = 14/17 (82%) Frame = -1 Query: 76 FIKTLFFVNWCSLGLEA 92 FI +LFF +WC++G+ + Sbjct: 599823 FITSLFFFHWCTMGIHS 599773 Database: T.congolense/genome.fa Posted date: Nov 21, 2011 7:47 PM Number of letters in database: 22,287,946 Number of sequences in database: 11 Lambda K H 0.324 0.137 0.417 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 5,983,559 Number of Sequences: 11 Number of extensions: 80363 Number of successful extensions: 436 Number of sequences better than 10.0: 4 Number of HSP's better than 10.0 without gapping: 3 Number of HSP's successfully gapped in prelim test: 1 Number of HSP's that attempted gapping in prelim test: 399 Number of HSP's gapped (non-prelim): 100 length of query: 241 length of database: 7,429,315 effective HSP length: 95 effective length of query: 146 effective length of database: 7,428,270 effective search space: 1084527420 effective search space used: 1084527420 frameshift window, decay const: 40, 0.1 T: 13 A: 40 X1: 15 ( 7.0 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 40 (21.6 bits) S2: 58 (26.9 bits)