TBLASTN 2.2.13 [Nov-27-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= gi|29165348|gb|AAO65268.1| iodothyronine deiodinase type I Deio1 [Danio rerio] (241 letters) Database: L.donovani_BPK282A1/genome.fa 36 sequences; 32,444,998 total letters Searching....................................done Score E Sequences producing significant alignments: (bits) Value contig_36 29 2.7 contig_34 28 7.8 >contig_36 Length = 2713248 Score = 29.3 bits (64), Expect = 2.7 Identities = 20/75 (26%), Positives = 33/75 (44%), Gaps = 5/75 (6%) Frame = -3 Query: 94 EGHAAPDSALITLDRQKTSVHRFLKGNRP-----LVLSFGSCTUPPFLYKLDEFKQLVKD 148 E +P ++ +++KT R G R LV S G C+ PP ++ QLV+ Sbjct: 1508851 ERKTSPPHERVSTEKRKTEQRRCSDGGRQGDRNQLVTSPGHCSSPPSVHLSQLTSQLVRQ 1508672 Query: 149 FSNVADFLIVYLAEA 163 D + ++L A Sbjct: 1508671 APLFCDSIRLFLRRA 1508627 >contig_34 Length = 1750858 Score = 27.7 bits (60), Expect = 7.8 Identities = 13/42 (30%), Positives = 22/42 (52%) Frame = -2 Query: 60 PKFRYEDWGPAFFSLAFIKTLFFVNWCSLGLEAFEGHAAPDS 101 PK +D G ++++ FV WC +G+ A H+A D+ Sbjct: 1333308 PKGAGDDAGVVLDPALRLRSISFVQWCPIGVHAGLIHSAGDA 1333183 Database: L.donovani_BPK282A1/genome.fa Posted date: Nov 21, 2011 7:46 PM Number of letters in database: 32,444,998 Number of sequences in database: 36 Lambda K H 0.324 0.137 0.417 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 9,639,825 Number of Sequences: 36 Number of extensions: 130064 Number of successful extensions: 679 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 1 Number of HSP's successfully gapped in prelim test: 2 Number of HSP's that attempted gapping in prelim test: 650 Number of HSP's gapped (non-prelim): 119 length of query: 241 length of database: 10,814,999 effective HSP length: 97 effective length of query: 144 effective length of database: 10,811,507 effective search space: 1556857008 effective search space used: 1556857008 frameshift window, decay const: 40, 0.1 T: 13 A: 40 X1: 15 ( 7.0 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 40 (21.6 bits) S2: 59 (27.3 bits)