TBLASTN 2.2.13 [Nov-27-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= gi|29165348|gb|AAO65268.1| iodothyronine deiodinase type I Deio1 [Danio rerio] (241 letters) Database: I.multifiliis_strain_G5/genome.fa 2017 sequences; 48,799,969 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gi|340500841|gb|GL984332.1| Ichthyophthirius multifiliis unplace... 30 2.3 gi|340507271|gb|GL983480.1| Ichthyophthirius multifiliis unplace... 29 3.9 >gi|340500841|gb|GL984332.1| Ichthyophthirius multifiliis unplaced genomic scaffold scaff_1120509251371, whole genome shotgun sequence Length = 42813 Score = 30.0 bits (66), Expect = 2.3 Identities = 12/29 (41%), Positives = 21/29 (72%) Frame = -2 Query: 199 PCPVVVDEMNNITASKYGALPERLYVIQS 227 PCP+ ++NI+ +KY +P+R+YV +S Sbjct: 19799 PCPL----LSNISGAKYSGVPQRVYVRES 19725 >gi|340507271|gb|GL983480.1| Ichthyophthirius multifiliis unplaced genomic scaffold scaff_1120509250224, whole genome shotgun sequence Length = 113126 Score = 29.3 bits (64), Expect = 3.9 Identities = 17/57 (29%), Positives = 27/57 (47%), Gaps = 1/57 (1%) Frame = +2 Query: 29 MSMLKLLSFISPGRMRKIHMKMGERSTMTQNPKFRYED-WGPAFFSLAFIKTLFFVN 84 M +K+L F PGR+ +H+K + K ++D W FF + FFV+ Sbjct: 70826 MEDIKVLLFQQPGRLTLMHLKQIHIKLKNRQGKLLFKDFWKKFFFLF*YFFN*FFVD 70996 Database: I.multifiliis_strain_G5/genome.fa Posted date: Nov 21, 2011 7:46 PM Number of letters in database: 48,799,969 Number of sequences in database: 2017 Lambda K H 0.324 0.137 0.417 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 14,242,648 Number of Sequences: 2017 Number of extensions: 189891 Number of successful extensions: 858 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 74 Number of HSP's successfully gapped in prelim test: 11 Number of HSP's that attempted gapping in prelim test: 758 Number of HSP's gapped (non-prelim): 154 length of query: 241 length of database: 16,266,656 effective HSP length: 100 effective length of query: 141 effective length of database: 16,064,956 effective search space: 2265158796 effective search space used: 2265158796 frameshift window, decay const: 40, 0.1 T: 13 A: 40 X1: 15 ( 7.0 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 40 (21.6 bits) S2: 61 (28.1 bits)