TBLASTN 2.2.13 [Nov-27-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= gi|29165348|gb|AAO65268.1| iodothyronine deiodinase type I Deio1 [Danio rerio] (241 letters) Database: A.rara/genome.fa 3231 sequences; 1,450,095 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gi|330848866|gb|ADNL01001737.1| Astrammina rara contig02062, who... 26 0.62 gi|330848213|gb|ADNL01002390.1| Astrammina rara contig02850, who... 24 3.1 gi|330847815|gb|ADNL01002788.1| Astrammina rara contig03279, who... 23 4.0 gi|330847944|gb|ADNL01002659.1| Astrammina rara contig03142, who... 23 6.8 gi|330849959|gb|ADNL01000644.1| Astrammina rara contig00724, who... 23 6.8 gi|330848434|gb|ADNL01002169.1| Astrammina rara contig02594, who... 22 8.9 >gi|330848866|gb|ADNL01001737.1| Astrammina rara contig02062, whole genome shotgun sequence Length = 239 Score = 26.2 bits (56), Expect = 0.62 Identities = 15/41 (36%), Positives = 22/41 (53%) Frame = -2 Query: 40 PGRMRKIHMKMGERSTMTQNPKFRYEDWGPAFFSLAFIKTL 80 PGR IH+ R T+ +FRY + +S+AF+ TL Sbjct: 145 PGRSSPIHIDYNTRQTLAHLIEFRY--MLASLWSVAFLWTL 29 >gi|330848213|gb|ADNL01002390.1| Astrammina rara contig02850, whole genome shotgun sequence Length = 865 Score = 23.9 bits (50), Expect = 3.1 Identities = 12/38 (31%), Positives = 20/38 (52%) Frame = -3 Query: 11 KLFVYISAVLMVCAAILQMSMLKLLSFISPGRMRKIHM 48 K+F+ S VL+ CA + L+S R+ K+H+ Sbjct: 326 KMFIARSFVLLACATTAVPTFTILVSNTPAYRLTKLHL 213 >gi|330847815|gb|ADNL01002788.1| Astrammina rara contig03279, whole genome shotgun sequence Length = 523 Score = 23.5 bits (49), Expect = 4.0 Identities = 13/27 (48%), Positives = 15/27 (55%) Frame = +2 Query: 86 CSLGLEAFEGHAAPDSALITLDRQKTS 112 C LG+ GH A D I LDR +TS Sbjct: 152 CFLGV----GHRATDFPKIVLDRSQTS 220 >gi|330847944|gb|ADNL01002659.1| Astrammina rara contig03142, whole genome shotgun sequence Length = 858 Score = 22.7 bits (47), Expect = 6.8 Identities = 9/23 (39%), Positives = 15/23 (65%) Frame = -3 Query: 23 CAAILQMSMLKLLSFISPGRMRK 45 CAA+L++S + + FIS + K Sbjct: 496 CAAVLRVSKISAIEFISATALLK 428 >gi|330849959|gb|ADNL01000644.1| Astrammina rara contig00724, whole genome shotgun sequence Length = 812 Score = 22.7 bits (47), Expect = 6.8 Identities = 12/45 (26%), Positives = 21/45 (46%) Frame = +2 Query: 196 EDPPCPVVVDEMNNITASKYGALPERLYVIQSGKVIYQASDLGGQ 240 + PPCP+ V E+ G RLY++ + + +D G+ Sbjct: 272 QQPPCPL*VSEL--------GEYMSRLYLVLTDNRASRVADTQGK 382 >gi|330848434|gb|ADNL01002169.1| Astrammina rara contig02594, whole genome shotgun sequence Length = 2535 Score = 22.3 bits (46), Expect = 8.9 Identities = 11/37 (29%), Positives = 18/37 (48%) Frame = +3 Query: 110 KTSVHRFLKGNRPLVLSFGSCTUPPFLYKLDEFKQLV 146 +T+VH GN ++ S + PFL+K + V Sbjct: 1179 RTTVHTVRTGNNATLMLSVSNSFKPFLHKSNNVSMYV 1289 Database: A.rara/genome.fa Posted date: Nov 21, 2011 7:46 PM Number of letters in database: 1,450,095 Number of sequences in database: 3231 Lambda K H 0.324 0.137 0.417 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 357,661 Number of Sequences: 3231 Number of extensions: 3978 Number of successful extensions: 19 Number of sequences better than 10.0: 6 Number of HSP's better than 10.0 without gapping: 19 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 19 length of query: 241 length of database: 483,365 effective HSP length: 72 effective length of query: 169 effective length of database: 250,733 effective search space: 42373877 effective search space used: 42373877 frameshift window, decay const: 40, 0.1 T: 13 A: 40 X1: 15 ( 7.0 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 40 (21.6 bits) S2: 46 (22.3 bits)