TBLASTN 2.2.13 [Nov-27-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= SPP00000003_1.0 # Protein # Iodothyronine deiodinase 3 (DI3) #
Homo sapiens # Complete
         (278 letters)

Database: /users/rg/didac/GENOMES/S.arctica/genome.fa 
           15,618 sequences; 121,588,341 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

supercont1.1104 of Sphaeroforma arctica JP610                          30   6.7  

>supercont1.1104 of Sphaeroforma arctica JP610
          Length = 22595

 Score = 30.0 bits (66), Expect = 6.7
 Identities = 19/63 (30%), Positives = 24/63 (38%), Gaps = 1/63 (1%)
 Frame = +1

Query: 46    LGRRRRGQPEPEVELNSEGEEVPPDDPPICVSDDNRLCTLASL-KAVWHGQKLDFFKQAH 104
             L   R     P       G  V     P+C+   N +C L SL  +V HG  L +F    
Sbjct: 16240 LQNTRESHTRPSPAYTPHGSHVIIRHSPVCLLHTNVICVLRSLVLSVGHGSPLVYFSAMI 16419

Query: 105   EGG 107
              GG
Sbjct: 16420 PGG 16428


  Database: /users/rg/didac/GENOMES/S.arctica/genome.fa
    Posted date:  Sep 29, 2011  6:14 PM
  Number of letters in database: 121,588,341
  Number of sequences in database:  15,618
  
Lambda     K      H
   0.322    0.139    0.438 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Hits to DB: 48,349,510
Number of Sequences: 15618
Number of extensions: 851751
Number of successful extensions: 2568
Number of sequences better than 10.0: 1
Number of HSP's better than 10.0 without gapping: 964
Number of HSP's successfully gapped in prelim test: 104
Number of HSP's that attempted gapping in prelim test: 1371
Number of HSP's gapped (non-prelim): 1575
length of query: 278
length of database: 40,529,447
effective HSP length: 108
effective length of query: 170
effective length of database: 38,842,703
effective search space: 6603259510
effective search space used: 6603259510
frameshift window, decay const: 40,  0.1
T: 13
A: 40
X1: 16 ( 7.4 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.9 bits)
S2: 65 (29.6 bits)