TBLASTN 2.2.13 [Nov-27-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= SPP00000003_1.0 # Protein # Iodothyronine deiodinase 3 (DI3) # Homo sapiens # Complete (278 letters) Database: /users/rg/didac/GENOMES/L.tarentolae/genome.fa 7267 sequences; 31,598,840 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Lt_contig6953 | | 1 to 5631 34 0.12 Lt_contig4817 | | 1 to 6196 29 3.1 Lt_contig3375 | | 1 to 2348 29 3.1 Lt_contig7013 | | 1 to 12919 28 5.2 Lt_contig3645 | | 1 to 5132 28 5.2 Lt_contig6395 | | 1 to 13447 28 5.2 Lt_contig6192 | | 1 to 3549 28 5.2 Lt_contig7058 | | 1 to 9347 28 8.9 >Lt_contig6953 | | 1 to 5631 Length = 5631 Score = 33.9 bits (76), Expect = 0.12 Identities = 24/74 (32%), Positives = 30/74 (40%), Gaps = 7/74 (9%) Frame = +1 Query: 46 LGRRRRGQPEPEVELNSEGEEVPPDDPPICVSDDNRLCTLASLKAVWHGQKLDFFKQAHE 105 LGRR QP P+ L PP PP R+ + +W G K +F + H Sbjct: 4576 LGRRGYRQPSPQTLLRVSAHGSPPTPPPPRPRTQRRIQQIHCATRIWCGTK-NFGLRTHG 4752 Query: 106 GGP-------APNS 112 G P APNS Sbjct: 4753 GVPTRSCTREAPNS 4794 >Lt_contig4817 | | 1 to 6196 Length = 6196 Score = 29.3 bits (64), Expect = 3.1 Identities = 15/54 (27%), Positives = 25/54 (46%) Frame = -2 Query: 28 GTAFMLWLLDFLCIRKHFLGRRRRGQPEPEVELNSEGEEVPPDDPPICVSDDNR 81 G+ + +L F C R + GRR R + + PP PP+ +++D R Sbjct: 3525 GSVHLPFLFAFTC-RIYACGRRSRSMSPVDASTDDPPPSSPPLSPPLMIANDER 3367 >Lt_contig3375 | | 1 to 2348 Length = 2348 Score = 29.3 bits (64), Expect = 3.1 Identities = 11/20 (55%), Positives = 13/20 (65%) Frame = -2 Query: 176 HPSDGWVTTDSPYIIPQHRS 195 HPS G + PYI+PQH S Sbjct: 1204 HPSAGAAAPEGPYIVPQHLS 1145 >Lt_contig7013 | | 1 to 12919 Length = 12919 Score = 28.5 bits (62), Expect = 5.2 Identities = 15/29 (51%), Positives = 15/29 (51%) Frame = +2 Query: 248 GRGPDGYQVSELRTWLERYDEQLHGARPR 276 G PD Q LR WL R L GARPR Sbjct: 7430 GPKPDP*QPHRLRRWLGRAGRILRGARPR 7516 >Lt_contig3645 | | 1 to 5132 Length = 5132 Score = 28.5 bits (62), Expect = 5.2 Identities = 11/15 (73%), Positives = 12/15 (80%) Frame = -3 Query: 40 CIRKHFLGRRRRGQP 54 C R HFLGRRRR +P Sbjct: 2595 CPRHHFLGRRRRDEP 2551 >Lt_contig6395 | | 1 to 13447 Length = 13447 Score = 28.5 bits (62), Expect = 5.2 Identities = 12/36 (33%), Positives = 23/36 (63%) Frame = +3 Query: 192 QHRSLEDRVSAARVLQQGAPGCALVLDTMANSSSSA 227 Q+RS+ + + +++G+ GCALVL S+++A Sbjct: 8139 QYRSVREVANLDATVEEGSSGCALVLTNGGGSAATA 8246 >Lt_contig6192 | | 1 to 3549 Length = 3549 Score = 28.5 bits (62), Expect = 5.2 Identities = 19/57 (33%), Positives = 24/57 (42%), Gaps = 2/57 (3%) Frame = +3 Query: 56 PEVELNSEGEEVPPDDPPICVSDDNRLCTLASL--KAVWHGQKLDFFKQAHEGGPAP 110 P L PP PP + D LC S+ +A W G + D +Q EG AP Sbjct: 459 PSRRLREHDRGSPPPPPPPPPNRDRSLCARTSMPARASWSG-RADAGRQVCEGWEAP 626 >Lt_contig7058 | | 1 to 9347 Length = 9347 Score = 27.7 bits (60), Expect = 8.9 Identities = 19/54 (35%), Positives = 25/54 (46%) Frame = +2 Query: 135 LVLNFGSCTUPPFMARMSAFQRLVTKYQRDVDFLIIYIEEAHPSDGWVTTDSPY 188 L L+F C P R+S VT L ++ E H S+G + TDSPY Sbjct: 8204 LTLSFCDCDDPAPHPRVSGTLVPVT--------LCLHTIEKHCSNGLIPTDSPY 8341 Database: /users/rg/didac/GENOMES/L.tarentolae/genome.fa Posted date: Sep 30, 2011 12:11 AM Number of letters in database: 31,598,840 Number of sequences in database: 7267 Lambda K H 0.322 0.139 0.438 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 15,436,255 Number of Sequences: 7267 Number of extensions: 352641 Number of successful extensions: 1419 Number of sequences better than 10.0: 8 Number of HSP's better than 10.0 without gapping: 1377 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1419 length of query: 278 length of database: 10,532,946 effective HSP length: 98 effective length of query: 180 effective length of database: 9,820,780 effective search space: 1767740400 effective search space used: 1767740400 frameshift window, decay const: 40, 0.1 T: 13 A: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.9 bits) S2: 60 (27.7 bits)