TBLASTN 2.2.13 [Nov-27-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= SPP00000003_1.0 # Protein # Iodothyronine deiodinase 3 (DI3) # Homo sapiens # Complete (278 letters) Database: /users/rg/didac/GENOMES/F.cylindrus/genome.fa 271 sequences; 80,540,407 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value scaffold_4 31 2.1 scaffold_88 30 6.1 scaffold_6 30 6.1 >scaffold_4 Length = 3206981 Score = 31.2 bits (69), Expect = 2.1 Identities = 18/43 (41%), Positives = 23/43 (53%), Gaps = 4/43 (9%) Frame = +2 Query: 223 SSSSAYGAYFERLYVIQSGTIMYQGGRGP----DGYQVSELRT 261 S+S YG+Y +R Y SGT+ GG+ P GYQ RT Sbjct: 1262015 SNSGLYGSYLDR*YPNGSGTMSTYGGK*PRRTDSGYQYIRRRT 1262143 >scaffold_88 Length = 172549 Score = 29.6 bits (65), Expect = 6.1 Identities = 17/47 (36%), Positives = 23/47 (48%) Frame = -2 Query: 13 CAQTASCLVLFPRFLGTAFMLWLLDFLCIRKHFLGRRRRGQPEPEVE 59 CA + SC VLF + T L L F + F+G G P+ E+E Sbjct: 118083 CALSISCAVLFGTYFSTLLSLTLKSFSSFVRIFIG----GLPQQELE 117955 >scaffold_6 Length = 2967614 Score = 29.6 bits (65), Expect = 6.1 Identities = 15/50 (30%), Positives = 26/50 (52%) Frame = +1 Query: 189 IIPQHRSLEDRVSAARVLQQGAPGCALVLDTMANSSSSAYGAYFERLYVI 238 ++P S+ + A+ L+ G P CA + S+S AYG+ L+V+ Sbjct: 627997 LLPGSDSVSETEKGAKKLELGEPNCARSVIDSIGSASIAYGSLKRDLHVL 628146 Database: /users/rg/didac/GENOMES/F.cylindrus/genome.fa Posted date: Sep 29, 2011 10:40 PM Number of letters in database: 80,540,407 Number of sequences in database: 271 Lambda K H 0.322 0.139 0.438 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 27,711,034 Number of Sequences: 271 Number of extensions: 443756 Number of successful extensions: 1644 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 14 Number of HSP's successfully gapped in prelim test: 7 Number of HSP's that attempted gapping in prelim test: 1477 Number of HSP's gapped (non-prelim): 447 length of query: 278 length of database: 26,846,802 effective HSP length: 105 effective length of query: 173 effective length of database: 26,818,347 effective search space: 4639574031 effective search space used: 4639574031 frameshift window, decay const: 40, 0.1 T: 13 A: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.9 bits) S2: 63 (28.9 bits)