TBLASTN 2.2.13 [Nov-27-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= SPP00000002_1.0 # Protein # Iodothyronine deiodinase 2 (DI2) #
Homo sapiens # Complete
         (265 letters)

Database: /users/rg/didac/GENOMES/I.multifiliis_strain_G5/genome.fa 
           2017 sequences; 48,799,969 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

gb|GL983107.1| Ichthyophthirius multifiliis unplaced genomic sca...    30   3.5  

>gb|GL983107.1| Ichthyophthirius multifiliis unplaced genomic scaffold
             scaff_1120509249536, whole genome shotgun sequence
          Length = 30310

 Score = 29.6 bits (65), Expect = 3.5
 Identities = 17/51 (33%), Positives = 25/51 (49%)
 Frame = -1

Query: 24    FLALYDSVILLKHVVLLLSRSKSTRGEWRRMLTSEGLRCVWKSFLLDAYKQ 74
             F+ L+  VILL+H+V  L           R+L +     +WKSF+   Y Q
Sbjct: 21007 FIVLFS*VILLRHIVRNLEMGNMRVFHLFRVLQNNSRWWLWKSFMKKNYCQ 20855


  Database: /users/rg/didac/GENOMES/I.multifiliis_strain_G5/genome.fa
    Posted date:  Sep 29, 2011 11:36 PM
  Number of letters in database: 48,799,969
  Number of sequences in database:  2017
  
Lambda     K      H
   0.321    0.136    0.408 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Hits to DB: 11,689,042
Number of Sequences: 2017
Number of extensions: 135446
Number of successful extensions: 957
Number of sequences better than 10.0: 1
Number of HSP's better than 10.0 without gapping: 118
Number of HSP's successfully gapped in prelim test: 25
Number of HSP's that attempted gapping in prelim test: 803
Number of HSP's gapped (non-prelim): 239
length of query: 265
length of database: 16,266,656
effective HSP length: 101
effective length of query: 164
effective length of database: 16,062,939
effective search space: 2634321996
effective search space used: 2634321996
frameshift window, decay const: 40,  0.1
T: 13
A: 40
X1: 16 ( 7.4 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.9 bits)
S2: 61 (28.1 bits)