TBLASTN 2.2.13 [Nov-27-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= SPP00000002_1.0 # Protein # Iodothyronine deiodinase 2 (DI2) # Homo sapiens # Complete (265 letters) Database: /users/rg/didac/GENOMES/A.rara/genome.fa 3231 sequences; 1,450,095 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|ADNL01002689.1| Astrammina rara contig03176, whole genome sho... 25 1.5 gb|ADNL01002587.1| Astrammina rara contig03062, whole genome sho... 24 2.6 gb|ADNL01002253.1| Astrammina rara contig02689, whole genome sho... 24 2.6 gb|ADNL01000209.1| Astrammina rara contig00219, whole genome sho... 23 4.5 gb|ADNL01002093.1| Astrammina rara contig02498, whole genome sho... 23 5.9 gb|ADNL01003135.1| Astrammina rara contig02446, whole genome sho... 23 7.7 gb|ADNL01001590.1| Astrammina rara contig01885, whole genome sho... 23 7.7 gb|ADNL01001383.1| Astrammina rara contig01638, whole genome sho... 23 7.7 >gb|ADNL01002689.1| Astrammina rara contig03176, whole genome shotgun sequence Length = 506 Score = 25.0 bits (53), Expect = 1.5 Identities = 16/42 (38%), Positives = 19/42 (45%) Frame = +3 Query: 206 PQCRVVADRMDNNANIAYGVAFERVCIVQRQKIAYLGGKGPF 247 PQ R + R+ NNA V FE C V + A K PF Sbjct: 54 PQFRAIEPRL-NNARFHTWVVFETACSVLKGAAAKQRHKVPF 176 >gb|ADNL01002587.1| Astrammina rara contig03062, whole genome shotgun sequence Length = 1906 Score = 24.3 bits (51), Expect = 2.6 Identities = 7/18 (38%), Positives = 13/18 (72%) Frame = -1 Query: 155 DFLLVYIDEAHPSDGWAI 172 + ++VY++ +HPS W I Sbjct: 1270 NLIIVYLNTSHPSSNWYI 1217 >gb|ADNL01002253.1| Astrammina rara contig02689, whole genome shotgun sequence Length = 4647 Score = 24.3 bits (51), Expect = 2.6 Identities = 10/28 (35%), Positives = 15/28 (53%) Frame = -1 Query: 134 PPFTSQLPAFRKLVEEFSSVADFLLVYI 161 PPF S +P+F + F +A L Y+ Sbjct: 2811 PPFVSVIPSFNLFIIMFLPIAFILSSYV 2728 >gb|ADNL01000209.1| Astrammina rara contig00219, whole genome shotgun sequence Length = 6385 Score = 23.5 bits (49), Expect = 4.5 Identities = 10/23 (43%), Positives = 16/23 (69%) Frame = -2 Query: 125 VVNFGSATUPPFTSQLPAFRKLV 147 +V+ ++T PPF S + + RKLV Sbjct: 1383 LVSLHTSTEPPFASVIRSARKLV 1315 >gb|ADNL01002093.1| Astrammina rara contig02498, whole genome shotgun sequence Length = 207 Score = 23.1 bits (48), Expect = 5.9 Identities = 10/30 (33%), Positives = 19/30 (63%) Frame = -2 Query: 9 LITLQILPVFFSNCLFLALYDSVILLKHVV 38 ++ L++LP+FF ++ S IL+ HV+ Sbjct: 116 ILYLRLLPLFFLFIIYRPELTSPILVLHVI 27 >gb|ADNL01003135.1| Astrammina rara contig02446, whole genome shotgun sequence Length = 173 Score = 22.7 bits (47), Expect = 7.7 Identities = 10/31 (32%), Positives = 16/31 (51%) Frame = -3 Query: 9 LITLQILPVFFSNCLFLALYDSVILLKHVVL 39 L+ L +F C F L+ +L+ HV+L Sbjct: 93 LLLFLFLLLFLDRCWFFWLFHLFVLIFHVLL 1 >gb|ADNL01001590.1| Astrammina rara contig01885, whole genome shotgun sequence Length = 482 Score = 22.7 bits (47), Expect = 7.7 Identities = 8/15 (53%), Positives = 10/15 (66%) Frame = +1 Query: 62 CVWKSFLLDAYKQVK 76 CVWKSF L + Q + Sbjct: 229 CVWKSFRLRTFAQFR 273 >gb|ADNL01001383.1| Astrammina rara contig01638, whole genome shotgun sequence Length = 707 Score = 22.7 bits (47), Expect = 7.7 Identities = 8/15 (53%), Positives = 12/15 (80%) Frame = -2 Query: 9 LITLQILPVFFSNCL 23 L+ LQILP+F +C+ Sbjct: 523 LMGLQILPIFMEDCV 479 Database: /users/rg/didac/GENOMES/A.rara/genome.fa Posted date: Sep 29, 2011 8:09 PM Number of letters in database: 1,450,095 Number of sequences in database: 3231 Lambda K H 0.321 0.136 0.408 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 466,035 Number of Sequences: 3231 Number of extensions: 5813 Number of successful extensions: 29 Number of sequences better than 10.0: 8 Number of HSP's better than 10.0 without gapping: 29 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 29 length of query: 265 length of database: 483,365 effective HSP length: 73 effective length of query: 192 effective length of database: 247,502 effective search space: 47520384 effective search space used: 47520384 frameshift window, decay const: 40, 0.1 T: 13 A: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.9 bits) S2: 46 (22.3 bits)