TBLASTN 2.2.13 [Nov-27-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= SPP00000001_1.0 # Protein # Iodothyronine deiodinase 1 (DI1) # Homo sapiens # Complete (249 letters) Database: /users/rg/didac/GENOMES/L.donovani_BPK282/genome.fa 36 sequences; 32,444,998 total letters Searching....................................done Score E Sequences producing significant alignments: (bits) Value contig_34 29 3.7 contig_27 28 6.3 contig_30 28 8.2 >contig_34 Length = 1750858 Score = 28.9 bits (63), Expect = 3.7 Identities = 17/54 (31%), Positives = 26/54 (48%) Frame = -1 Query: 33 FPDRVKRNILAMGEKTGMTRNPHFSHDNWIPTFFSTQYFWFVLKVRWQRLEDTT 86 F R + + E+T R + SH+ WI FS FW + VR+ + +TT Sbjct: 1246060 FTRRTR*GRASASEETLSHRQKYTSHNKWI-NEFSLSSFWLMKAVRYSGVLNTT 1245902 >contig_27 Length = 1024085 Score = 28.1 bits (61), Expect = 6.3 Identities = 12/26 (46%), Positives = 16/26 (61%) Frame = +1 Query: 92 APNCPVVRLSGQRCNIWEFMQGNRPL 117 AP+C VR+SG+ IWE G R + Sbjct: 735742 APSCVCVRVSGRGKKIWELK*GGREM 735819 >contig_30 Length = 1374157 Score = 27.7 bits (60), Expect = 8.2 Identities = 15/39 (38%), Positives = 23/39 (58%), Gaps = 2/39 (5%) Frame = +1 Query: 159 ASDGWAFKNNMDIRNHQNLQDRLQAA--HLLLARSPQCP 195 AS+ + + + R+HQ + RL+ A HLLL R +CP Sbjct: 1219165 ASERFRSRQHRKRRSHQRRRRRLRVAHLHLLLRRQRRCP 1219281 Database: /users/rg/didac/GENOMES/L.donovani_BPK282/genome.fa Posted date: Oct 4, 2011 6:44 PM Number of letters in database: 32,444,998 Number of sequences in database: 36 Lambda K H 0.324 0.138 0.448 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 10,536,649 Number of Sequences: 36 Number of extensions: 150004 Number of successful extensions: 806 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 1 Number of HSP's successfully gapped in prelim test: 2 Number of HSP's that attempted gapping in prelim test: 787 Number of HSP's gapped (non-prelim): 68 length of query: 249 length of database: 10,814,999 effective HSP length: 98 effective length of query: 151 effective length of database: 10,811,471 effective search space: 1632532121 effective search space used: 1632532121 frameshift window, decay const: 40, 0.1 T: 13 A: 40 X1: 15 ( 7.0 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 40 (21.5 bits) S2: 59 (27.3 bits)