TBLASTN 2.2.13 [Nov-27-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= SPP00000001_1.0 # Protein # Iodothyronine deiodinase 1 (DI1) # Homo sapiens # Complete (249 letters) Database: /users/rg/didac/GENOMES/D.discoideum_AX4/genome.fa 6 sequences; 33,943,072 total letters Searching......done Score E Sequences producing significant alignments: (bits) Value gb|CM000151.3| Dictyostelium discoideum AX4 chromosome 2, whole ... 87 9e-18 gb|CM000150.2| Dictyostelium discoideum AX4 chromosome 1, whole ... 30 2.3 gb|CM000155.2| Dictyostelium discoideum AX4 chromosome 6, whole ... 29 3.0 gb|CM000153.2| Dictyostelium discoideum AX4 chromosome 4, whole ... 28 6.6 >gb|CM000151.3| Dictyostelium discoideum AX4 chromosome 2, whole genome shotgun sequence Length = 8484197 Score = 87.4 bits (215), Expect = 9e-18 Identities = 46/138 (33%), Positives = 76/138 (55%), Gaps = 5/138 (3%) Frame = +3 Query: 114 NRPLVLNFGSCTUPSFMFKFDQFKRLIEDFSSIADFLVIYIEEAHASDGWAFKNN---MD 170 +RP+VL GS T P F K F+ + DF D ++Y++E H +D W + + Sbjct: 5885022 DRPMVLICGSFT*PPFRDKMCMFQDIFVDFKEWVDIYIVYLKEIHPADEWYIGGDEISLC 5885201 Query: 171 IRNHQNLQDRLQAAHLLLARSPQC--PVVVDTMQNQSSQLYAALPERLYIIQEGRILYKG 228 R + ++DR + L +P C P ++D M N +++Y A+PERLY++++ + Y G Sbjct: 5885202 YRQPKTMEDRREIIKDLKEYAPFCTIPFLIDKMDNNFNKVYDAVPERLYVLEDKKFKYVG 5885381 Query: 229 KSGPWNYNPEEVRAVLEK 246 GP+ + PEE+R L K Sbjct: 5885382 GPGPFGFIPEELREFLTK 5885435 >gb|CM000150.2| Dictyostelium discoideum AX4 chromosome 1, whole genome shotgun sequence Length = 4923596 Score = 29.6 bits (65), Expect = 2.3 Identities = 14/52 (26%), Positives = 28/52 (53%) Frame = +2 Query: 70 YFWFVLKVRWQRLEDTTELGGLAPNCPVVRLSGQRCNIWEFMQGNRPLVLNF 121 +F+F K +++ ++G +AP+ GQ + EF + ++P+VL F Sbjct: 2415542 HFFFKKKYIYKKRMTKLKVGNIAPDFEAKNYLGQTVTLKEFKEKSQPIVLYF 2415697 >gb|CM000155.2| Dictyostelium discoideum AX4 chromosome 6, whole genome shotgun sequence Length = 3602379 Score = 29.3 bits (64), Expect = 3.0 Identities = 16/37 (43%), Positives = 24/37 (64%) Frame = +1 Query: 38 KRNILAMGEKTGMTRNPHFSHDNWIPTFFSTQYFWFV 74 KRNI +KT + NP F+H + I FF+ +YF+F+ Sbjct: 1021387 KRNIY*NRKKTHI*NNPTFNHHHLI-FFFTYKYFFFL 1021494 >gb|CM000153.2| Dictyostelium discoideum AX4 chromosome 4, whole genome shotgun sequence Length = 5450249 Score = 28.1 bits (61), Expect = 6.6 Identities = 11/32 (34%), Positives = 19/32 (59%) Frame = -1 Query: 70 YFWFVLKVRWQRLEDTTELGGLAPNCPVVRLS 101 +F+F K W+R +D T L + C ++R+S Sbjct: 4009931 FFFFFFKEHWKRSDDITSLK*IFFFCKIIRIS 4009836 Database: /users/rg/didac/GENOMES/D.discoideum_AX4/genome.fa Posted date: Sep 29, 2011 8:31 PM Number of letters in database: 33,943,072 Number of sequences in database: 6 Lambda K H 0.324 0.138 0.448 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 10,852,651 Number of Sequences: 6 Number of extensions: 193210 Number of successful extensions: 1035 Number of sequences better than 10.0: 4 Number of HSP's better than 10.0 without gapping: 3 Number of HSP's successfully gapped in prelim test: 1 Number of HSP's that attempted gapping in prelim test: 917 Number of HSP's gapped (non-prelim): 259 length of query: 249 length of database: 11,314,357 effective HSP length: 98 effective length of query: 151 effective length of database: 11,313,769 effective search space: 1708379119 effective search space used: 1708379119 frameshift window, decay const: 40, 0.1 T: 13 A: 40 X1: 15 ( 7.0 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 40 (21.5 bits) S2: 60 (27.7 bits)