TBLASTN 2.2.13 [Nov-27-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= SPP00000016_1.0 # Protein # Selenoprotein K (SelK) # Homo
sapiens # Complete
         (94 letters)

Database: P.capsici/genome.fa 
           917 sequences; 64,023,748 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

PHYCAscaffold_2                                                        45   2e-05

>PHYCAscaffold_2
          Length = 1925921

 Score = 45.1 bits (105), Expect = 2e-05
 Identities = 19/38 (50%), Positives = 25/38 (65%)
 Frame = -2

Query: 1      MVYISNGQVLDSRSQSPWRLSLITDFFWGIAEFVVLFF 38
              M Y+S G V+  RS  PWRLS++TD  WG+  FV L +
Sbjct: 491284 MTYVSGGDVVAKRS--PWRLSIVTDMIWGVVNFVGLLY 491177


  Database: P.capsici/genome.fa
    Posted date:  Nov 21, 2011  7:46 PM
  Number of letters in database: 64,023,748
  Number of sequences in database:  917
  
Lambda     K      H
   0.325    0.138    0.420 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Hits to DB: 4,821,264
Number of Sequences: 917
Number of extensions: 44809
Number of successful extensions: 313
Number of sequences better than 1.0e-04: 1
Number of HSP's better than  0.0 without gapping: 35
Number of HSP's successfully gapped in prelim test: 7
Number of HSP's that attempted gapping in prelim test: 253
Number of HSP's gapped (non-prelim): 107
length of query: 94
length of database: 21,341,249
effective HSP length: 69
effective length of query: 25
effective length of database: 21,277,976
effective search space: 531949400
effective search space used: 531949400
frameshift window, decay const: 40,  0.1
T: 13
A: 40
X1: 15 ( 7.0 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 40 (21.6 bits)
S2: 98 (42.4 bits)