TBLASTN 2.2.13 [Nov-27-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= SPP00000004_1.0 # Protein # Glutathione peroxidase 1 (GPx1) # Homo sapiens # Complete (203 letters) Database: S.arctica/genome.fa 15,618 sequences; 121,588,341 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value supercont1.626 of Sphaeroforma arctica JP610 60 5e-09 supercont1.676 of Sphaeroforma arctica JP610 29 8.7 >supercont1.626 of Sphaeroforma arctica JP610 Length = 54852 Score = 59.7 bits (143), Expect = 5e-09 Identities = 30/71 (42%), Positives = 46/71 (64%) Frame = -2 Query: 12 AAQSVYAFSARPLAGGEPVSLGSLRGKVLLIENVASLXGTTVRDYTQMNELQRRLGPRGL 71 A Q+VY+F+ + + G E + + + +G V++ NVAS G T +YTQ+ L R+ +GL Sbjct: 17954 AYQNVYSFTHKSIDGDE-IPMETYKGNVIVAVNVASE*GLTKANYTQLEALDRQYRDKGL 17778 Query: 72 VVLGFPCNQFG 82 +L FPCNQFG Sbjct: 17777 KILAFPCNQFG 17745 >supercont1.676 of Sphaeroforma arctica JP610 Length = 50765 Score = 28.9 bits (63), Expect = 8.7 Identities = 18/67 (26%), Positives = 31/67 (46%), Gaps = 5/67 (7%) Frame = -3 Query: 142 ALMTDPKLITWSPVCRNDVAWNFEKFLVGPDGVPLRR-----YSRRFQTIDIEPDIEALL 196 A + + + W P+ + + +NF LV P VP+ R Y + ++ DIE+ L Sbjct: 35016 AKLIESSSLRWVPLQQYNSEYNFNPLLVVPMHVPIYR*VCEAYGGKGFLVEKHEDIESTL 34837 Query: 197 SQGPSCA 203 +Q A Sbjct: 34836 AQAKEAA 34816 Database: S.arctica/genome.fa Posted date: Nov 21, 2011 7:47 PM Number of letters in database: 121,588,341 Number of sequences in database: 15,618 Lambda K H 0.321 0.137 0.418 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 26,517,078 Number of Sequences: 15618 Number of extensions: 370857 Number of successful extensions: 1458 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 1012 Number of HSP's successfully gapped in prelim test: 30 Number of HSP's that attempted gapping in prelim test: 325 Number of HSP's gapped (non-prelim): 1230 length of query: 203 length of database: 40,529,447 effective HSP length: 104 effective length of query: 99 effective length of database: 38,905,175 effective search space: 3851612325 effective search space used: 3851612325 frameshift window, decay const: 40, 0.1 T: 13 A: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 63 (28.9 bits)