TBLASTN 2.2.13 [Nov-27-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= SPP00000004_1.0 # Protein # Glutathione peroxidase 1 (GPx1) # Homo sapiens # Complete (203 letters) Database: P.polycephalum/genome.fa 297,657 sequences; 319,018,052 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Contig101170 202 202 31 3.2 Contig3967 9950 26738 30 5.5 >Contig101170 202 202 Length = 202 Score = 31.2 bits (69), Expect = 3.2 Identities = 18/46 (39%), Positives = 26/46 (56%) Frame = +3 Query: 111 LFEKCEVNGAGAHPLFAFLREALPAPSDDATALMTDPKLITWSPVC 156 +F K VN PL F+ LPAP +T+L + P L++ SP+C Sbjct: 60 IFFKISVNSPS--PLSPFI-SILPAPHSSSTSLFSLPSLLSISPLC 188 >Contig3967 9950 26738 Length = 26738 Score = 30.4 bits (67), Expect = 5.5 Identities = 20/57 (35%), Positives = 27/57 (47%), Gaps = 2/57 (3%) Frame = +2 Query: 119 GAGAHPLFAFLREALPAPSDDATALMTDPKLITWS--PVCRNDVAWNFEKFLVGPDG 173 G HPL+ L P S + + KL ++ P +D+ WNFEKFLV G Sbjct: 19427 GDAQHPLYHTLTSEFPK-STISNGDAFEKKLASYGLPPRQGSDIIWNFEKFLVDRHG 19594 Score = 29.6 bits (65), Expect = 9.3 Identities = 15/36 (41%), Positives = 19/36 (52%), Gaps = 2/36 (5%) Frame = +3 Query: 65 RLGPRGLVVLGFPCNQFGHQENAKNEEILN--SLKY 98 R +G + FPCN FG QE + EI + S KY Sbjct: 19002 RYKDQGFTIAAFPCNDFGAQEPGTDAEIKDFCSTKY 19109 Database: P.polycephalum/genome.fa Posted date: Nov 21, 2011 7:46 PM Number of letters in database: 319,018,052 Number of sequences in database: 297,657 Lambda K H 0.321 0.137 0.418 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 71,982,699 Number of Sequences: 297657 Number of extensions: 1072451 Number of successful extensions: 4808 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 4636 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 4777 length of query: 203 length of database: 106,339,350 effective HSP length: 108 effective length of query: 95 effective length of database: 74,192,394 effective search space: 7048277430 effective search space used: 7048277430 frameshift window, decay const: 40, 0.1 T: 13 A: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 65 (29.6 bits)