TBLASTN 2.2.13 [Nov-27-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= SPP00000004_1.0 # Protein # Glutathione peroxidase 1 (GPx1) # Homo sapiens # Complete (203 letters) Database: I.multifiliis_strain_G5/genome.fa 2017 sequences; 48,799,969 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gi|340505327|gb|GL983833.1| Ichthyophthirius multifiliis unplace... 32 0.59 gi|340501555|gb|GL984262.1| Ichthyophthirius multifiliis unplace... 30 1.7 >gi|340505327|gb|GL983833.1| Ichthyophthirius multifiliis unplaced genomic scaffold scaff_1120509250869, whole genome shotgun sequence Length = 31548 Score = 31.6 bits (70), Expect = 0.59 Identities = 14/38 (36%), Positives = 23/38 (60%) Frame = -1 Query: 159 DVAWNFEKFLVGPDGVPLRRYSRRFQTIDIEPDIEALL 196 ++ WNF KFL+ +G R Y+ + ++ P+IE LL Sbjct: 2364 NIPWNFGKFLINKEGKVHRFYTPKEMPNEMIPEIEKLL 2251 >gi|340501555|gb|GL984262.1| Ichthyophthirius multifiliis unplaced genomic scaffold scaff_1120509251301, whole genome shotgun sequence Length = 54917 Score = 30.0 bits (66), Expect = 1.7 Identities = 27/105 (25%), Positives = 51/105 (48%), Gaps = 2/105 (1%) Frame = -3 Query: 28 EPVSLGSL-RGKVLLIENVASLXGTTVRDYTQMNELQRRLGPRGLVVLGFPCNQFGHQE- 85 E + +G + + KV+++ N+ S ++NEL++R + +LG P N F ++ Sbjct: 30630 EEILIGDITKNKVVIVVNLGS*NNCY*E*INKLNELKKRFA-N*VEILGIPSN*FHNEPF 30454 Query: 86 NAKNEEILNSLKYVRPGGGFEPNFMLFEKCEVNGAGAHPLFAFLR 130 N + + ++ K P + K E+NG HPL+ FL+ Sbjct: 30453 NYEKTK*IHL*KC*FP---------ILGKLEING*YIHPLYKFLK 30346 Database: I.multifiliis_strain_G5/genome.fa Posted date: Nov 21, 2011 7:46 PM Number of letters in database: 48,799,969 Number of sequences in database: 2017 Lambda K H 0.321 0.137 0.418 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 6,113,337 Number of Sequences: 2017 Number of extensions: 57358 Number of successful extensions: 90 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 16 Number of HSP's successfully gapped in prelim test: 5 Number of HSP's that attempted gapping in prelim test: 74 Number of HSP's gapped (non-prelim): 22 length of query: 203 length of database: 16,266,656 effective HSP length: 98 effective length of query: 105 effective length of database: 16,068,990 effective search space: 1687243950 effective search space used: 1687243950 frameshift window, decay const: 40, 0.1 T: 13 A: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 59 (27.3 bits)