TBLASTN 2.2.13 [Nov-27-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= SPP00000004_1.0 # Protein # Glutathione peroxidase 1 (GPx1) #
Homo sapiens # Complete
         (203 letters)

Database: D.fasciculatum/genome.fa 
           25 sequences; 31,019,208 total letters

Searching.........................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

gi|328871378|gb|GL883013.1| Dictyostelium fasciculatum unplaced ...    28   3.3  

>gi|328871378|gb|GL883013.1| Dictyostelium fasciculatum unplaced genomic
               scaffold Scf_ET2XIPL01CNAVH-3, whole genome shotgun sequence
          Length = 1908399

 Score = 28.5 bits (62), Expect = 3.3
 Identities = 15/37 (40%), Positives = 21/37 (56%)
 Frame = -3

Query: 30      VSLGSLRGKVLLIENVASLXGTTVRDYTQMNELQRRL 66
               VSLG     +++I NV SL  +T +DY  +N  Q  L
Sbjct: 1304209 VSLGIQMVNIMVITNVLSLQSSTNKDYCLLNIYQNML 1304099


  Database: D.fasciculatum/genome.fa
    Posted date:  Nov 21, 2011  7:46 PM
  Number of letters in database: 31,019,208
  Number of sequences in database:  25
  
Lambda     K      H
   0.321    0.137    0.418 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Hits to DB: 5,606,315
Number of Sequences: 25
Number of extensions: 72466
Number of successful extensions: 223
Number of sequences better than 10.0: 1
Number of HSP's better than 10.0 without gapping: 1
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 219
Number of HSP's gapped (non-prelim): 16
length of query: 203
length of database: 10,339,736
effective HSP length: 95
effective length of query: 108
effective length of database: 10,337,361
effective search space: 1116434988
effective search space used: 1116434988
frameshift window, decay const: 40,  0.1
T: 13
A: 40
X1: 16 ( 7.4 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.8 bits)
S2: 58 (26.9 bits)