TBLASTN 2.2.13 [Nov-27-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= gi|298566227|ref|NP_001177288.1| disulfide bond formation protein A [Ciona intestinalis] (214 letters) Database: P.capsici/genome.fa 917 sequences; 64,023,748 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value PHYCAscaffold_5 30 3.2 PHYCAscaffold_29 28 9.3 >PHYCAscaffold_5 Length = 1593284 Score = 29.6 bits (65), Expect = 3.2 Identities = 20/78 (25%), Positives = 40/78 (51%) Frame = -1 Query: 137 STVAATCGLNREEVKSFISDESNLAAVKRKAAQWSANGVSGVPYFIINDCPVFSGAQEPA 196 ST++ L+ + SF++ SN A+ Q S++G S + + + P+FS + PA Sbjct: 89654 STLSGCTPLSAQRFSSFLN--SNTLALSASNVQ-SSSGESALIMTVASSRPMFSSSSSPA 89484 Query: 197 AFQNIFAKVAEKYPMPSQ 214 A + A++ +P++ Sbjct: 89483 AVALVGAELLGAVALPNE 89430 >PHYCAscaffold_29 Length = 707326 Score = 28.1 bits (61), Expect = 9.3 Identities = 13/28 (46%), Positives = 15/28 (53%) Frame = -3 Query: 185 DCPVFSGAQEPAAFQNIFAKVAEKYPMP 212 DCPV SGA+ F+ K YPMP Sbjct: 692237 DCPVSSGAKTLPRFETSATKCRCHYPMP 692154 Database: P.capsici/genome.fa Posted date: Nov 21, 2011 7:46 PM Number of letters in database: 64,023,748 Number of sequences in database: 917 Lambda K H 0.319 0.134 0.413 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 16,018,763 Number of Sequences: 917 Number of extensions: 211069 Number of successful extensions: 838 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 20 Number of HSP's successfully gapped in prelim test: 13 Number of HSP's that attempted gapping in prelim test: 761 Number of HSP's gapped (non-prelim): 198 length of query: 214 length of database: 21,341,249 effective HSP length: 100 effective length of query: 114 effective length of database: 21,249,549 effective search space: 2422448586 effective search space used: 2422448586 frameshift window, decay const: 40, 0.1 T: 13 A: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 61 (28.1 bits)