TBLASTN 2.2.13 [Nov-27-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= gi|298566227|ref|NP_001177288.1| disulfide bond formation protein A [Ciona intestinalis] (214 letters) Database: D.discoideum_AX4/genome.fa 6 sequences; 33,943,072 total letters Searching......done Score E Sequences producing significant alignments: (bits) Value gi|93569069|gb|CM000154.2| Dictyostelium discoideum AX4 chromoso... 28 6.7 gi|93569058|gb|CM000155.2| Dictyostelium discoideum AX4 chromoso... 27 8.8 >gi|93569069|gb|CM000154.2| Dictyostelium discoideum AX4 chromosome 5, whole genome shotgun sequence Length = 5125352 Score = 27.7 bits (60), Expect = 6.7 Identities = 16/52 (30%), Positives = 27/52 (51%), Gaps = 4/52 (7%) Frame = +2 Query: 20 VGKRNLETAMKASENEYKFKVTWEPFL--LRPNMP--LEGIAKQGDFGPHTP 67 +GK ++T + N+YKFK T +P + PN+ L+ + GD + P Sbjct: 2623424 LGKNAIQTTIGMKTNKYKFKHTPKPICIPINPNIDIILQAVL*NGDINNNGP 2623579 >gi|93569058|gb|CM000155.2| Dictyostelium discoideum AX4 chromosome 6, whole genome shotgun sequence Length = 3602379 Score = 27.3 bits (59), Expect = 8.8 Identities = 21/77 (27%), Positives = 33/77 (42%), Gaps = 3/77 (3%) Frame = +2 Query: 87 QPRYPYTLFGHCALEFAIKK---DPSGSIQTQLQESLFKSYFTDGEYPDVETVSTVAATC 143 QP YP T+ G C+ + KK + S L+++L Y + ++ + Sbjct: 161360 QPSYPITIEGECSPKTFFKKMSIEFSPYQSLNLKKNLTNPYSSSSTTTYSNNPTSSSPNT 161539 Query: 144 GLNREEVKSFISDESNL 160 LN S I+D SNL Sbjct: 161540 FLNNNYPNSKINDSSNL 161590 Database: D.discoideum_AX4/genome.fa Posted date: Nov 21, 2011 7:46 PM Number of letters in database: 33,943,072 Number of sequences in database: 6 Lambda K H 0.319 0.134 0.413 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 6,673,122 Number of Sequences: 6 Number of extensions: 75067 Number of successful extensions: 214 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 0 Number of HSP's successfully gapped in prelim test: 2 Number of HSP's that attempted gapping in prelim test: 205 Number of HSP's gapped (non-prelim): 22 length of query: 214 length of database: 11,314,357 effective HSP length: 96 effective length of query: 118 effective length of database: 11,313,781 effective search space: 1335026158 effective search space used: 1335026158 frameshift window, decay const: 40, 0.1 T: 13 A: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 59 (27.3 bits)