TBLASTN 2.2.13 [Nov-27-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= gi|298566227|ref|NP_001177288.1| disulfide bond formation protein A [Ciona intestinalis] (214 letters) Database: A.rara/genome.fa 3231 sequences; 1,450,095 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gi|330847614|gb|ADNL01002989.1| Astrammina rara contig00538, who... 23 4.5 gi|330848268|gb|ADNL01002335.1| Astrammina rara contig02788, who... 23 5.9 gi|330849358|gb|ADNL01001245.1| Astrammina rara contig01464, who... 23 5.9 gi|330848194|gb|ADNL01002409.1| Astrammina rara contig02872, who... 22 7.7 gi|330850316|gb|ADNL01000287.1| Astrammina rara contig00298, who... 22 7.7 >gi|330847614|gb|ADNL01002989.1| Astrammina rara contig00538, whole genome shotgun sequence Length = 1110 Score = 23.1 bits (48), Expect = 4.5 Identities = 8/13 (61%), Positives = 11/13 (84%) Frame = +2 Query: 4 FLHIRVVSDIMXP 16 FLH+RVV+D+ P Sbjct: 38 FLHLRVVADLFFP 76 >gi|330848268|gb|ADNL01002335.1| Astrammina rara contig02788, whole genome shotgun sequence Length = 235 Score = 22.7 bits (47), Expect = 5.9 Identities = 9/27 (33%), Positives = 15/27 (55%) Frame = +3 Query: 157 ESNLAAVKRKAAQWSANGVSGVPYFII 183 ESN ++ KA +W+ V PY ++ Sbjct: 15 ESNPRPIQAKAYEWTGRNVYI*PYVVV 95 >gi|330849358|gb|ADNL01001245.1| Astrammina rara contig01464, whole genome shotgun sequence Length = 1067 Score = 22.7 bits (47), Expect = 5.9 Identities = 9/21 (42%), Positives = 12/21 (57%) Frame = -2 Query: 66 TPGAQRLINVGRKVGVEFAFK 86 TPG RLI +G K+ F+ Sbjct: 193 TPGMHRLIGIGAKMDRALVFR 131 >gi|330848194|gb|ADNL01002409.1| Astrammina rara contig02872, whole genome shotgun sequence Length = 2547 Score = 22.3 bits (46), Expect = 7.7 Identities = 9/27 (33%), Positives = 14/27 (51%) Frame = +2 Query: 4 FLHIRVVSDIMXPWCWVGKRNLETAMK 30 FLH V + WVGK+N + ++ Sbjct: 1541 FLHYLSVQKFVFLVLWVGKKNASSGVR 1621 >gi|330850316|gb|ADNL01000287.1| Astrammina rara contig00298, whole genome shotgun sequence Length = 2354 Score = 22.3 bits (46), Expect = 7.7 Identities = 13/54 (24%), Positives = 23/54 (42%) Frame = +2 Query: 122 KSYFTDGEYPDVETVSTVAATCGLNREEVKSFISDESNLAAVKRKAAQWSANGV 175 +S F DG+ ++ ++ A N EEV SD +++ A A + Sbjct: 1784 QSVFGDGDTETIKALNESIAETKANLEEVADAASDAADVVVTNFAEAVSEAGAI 1945 Database: A.rara/genome.fa Posted date: Nov 21, 2011 7:46 PM Number of letters in database: 1,450,095 Number of sequences in database: 3231 Lambda K H 0.319 0.134 0.413 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 334,208 Number of Sequences: 3231 Number of extensions: 3681 Number of successful extensions: 16 Number of sequences better than 10.0: 5 Number of HSP's better than 10.0 without gapping: 16 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 16 length of query: 214 length of database: 483,365 effective HSP length: 71 effective length of query: 143 effective length of database: 253,964 effective search space: 36316852 effective search space used: 36316852 frameshift window, decay const: 40, 0.1 T: 13 A: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 45 (21.9 bits)