TBLASTN 2.2.13 [Nov-27-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= SelH-P.tricornutum (113 letters) Database: /users/rg/didac/GENOMES/C.fasciculata/genome.fa 1089 sequences; 37,048,325 total letters Searching...................................................done Score E Sequences producing significant alignments: (bits) Value Cf_Contig690 | | 1 to 61350 26 6.3 Cf_Contig968 | | 1 to 318049 25 8.3 >Cf_Contig690 | | 1 to 61350 Length = 61350 Score = 25.8 bits (55), Expect = 6.3 Identities = 11/22 (50%), Positives = 14/22 (63%) Frame = -2 Query: 51 KAVGDKAKISINAEKPGKGNFV 72 + VGD A + I EKPG+G V Sbjct: 40235 RGVGDAASLGILGEKPGEGGDV 40170 >Cf_Contig968 | | 1 to 318049 Length = 318049 Score = 25.4 bits (54), Expect = 8.3 Identities = 11/35 (31%), Positives = 18/35 (51%) Frame = -3 Query: 35 ACKQXGAFKTRANTIVKAVGDKAKISINAEKPGKG 69 AC+Q AF +T V+ G+K + + +K G Sbjct: 130427 ACRQ*AAFPHAVDTAVRQSGEKKSVRVKRKKEVSG 130323 Database: /users/rg/didac/GENOMES/C.fasciculata/genome.fa Posted date: Sep 29, 2011 8:09 PM Number of letters in database: 37,048,325 Number of sequences in database: 1089 Lambda K H 0.316 0.134 0.374 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 2,730,859 Number of Sequences: 1089 Number of extensions: 26606 Number of successful extensions: 158 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 29 Number of HSP's successfully gapped in prelim test: 6 Number of HSP's that attempted gapping in prelim test: 126 Number of HSP's gapped (non-prelim): 45 length of query: 113 length of database: 12,349,441 effective HSP length: 86 effective length of query: 27 effective length of database: 12,255,787 effective search space: 330906249 effective search space used: 330906249 frameshift window, decay const: 40, 0.1 T: 13 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.6 bits) S2: 53 (25.0 bits)