TBLASTN 2.2.13 [Nov-27-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= gi|67191194|ref|NP_001019905.1| selenoprotein S [Gallus gallus] (194 letters) Database: I.multifiliis_strain_G5/genome.fa 2017 sequences; 48,799,969 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gi|340506985|gb|GL983521.1| Ichthyophthirius multifiliis unplace... 29 2.7 gi|340501650|gb|GL984247.1| Ichthyophthirius multifiliis unplace... 28 7.8 >gi|340506985|gb|GL983521.1| Ichthyophthirius multifiliis unplaced genomic scaffold scaff_1120509250296, whole genome shotgun sequence Length = 79067 Score = 29.3 bits (64), Expect = 2.7 Identities = 10/27 (37%), Positives = 21/27 (77%) Frame = +1 Query: 94 QEELNAQAERYKEKQRQLEEQKRRQKI 120 +++ Q E+Y+EKQ + +E+K+++KI Sbjct: 46696 EKQKEKQEEKYEEKQEEKQEEKQKEKI 46776 Score = 28.5 bits (62), Expect = 4.6 Identities = 18/68 (26%), Positives = 30/68 (44%), Gaps = 6/68 (8%) Frame = +1 Query: 100 QAERYKEKQRQLEEQK------RRQKIEMWESMQEGKSYKGNLKLSQQEAESGASTSSAV 153 Q E+Y+EKQ + +E+K +QK + + +E + K K + + E Sbjct: 46486 QEEKYEEKQEENKEEK*EENQEEKQKKKQEKKQEENQEEKYEEKQEENKEEK*EENQEEK 46665 Query: 154 PKSKPNKK 161 K K KK Sbjct: 46666 QKKKQEKK 46689 Score = 27.7 bits (60), Expect = 7.8 Identities = 17/60 (28%), Positives = 31/60 (51%) Frame = +1 Query: 83 QEALLASRLRMQEELNAQAERYKEKQRQLEEQKRRQKIEMWESMQEGKSYKGNLKLSQQE 142 QE + ++E N Q E+Y+EKQ + +E+K + E + ++ K + K Q+E Sbjct: 46546 QEEKQKKKQEKKQEEN-QEEKYEEKQEENKEEK*EENQEEKQKKKQEKKQEEKQKEKQEE 46722 >gi|340501650|gb|GL984247.1| Ichthyophthirius multifiliis unplaced genomic scaffold scaff_1120509251286, whole genome shotgun sequence Length = 122534 Score = 27.7 bits (60), Expect = 7.8 Identities = 18/76 (23%), Positives = 35/76 (46%), Gaps = 3/76 (3%) Frame = -2 Query: 92 RMQEELNAQAERYKEKQ---RQLEEQKRRQKIEMWESMQEGKSYKGNLKLSQQEAESGAS 148 + +E+ + YKEK+ + L+E+K+++K + + K K K + E Sbjct: 38170 KKKEDKKKNKKNYKEKKKNKKDLKEKKKKKKDLKDKKGKSKKDLKEKKKNKKDLKEKKGK 37991 Query: 149 TSSAVPKSKPNKKPLR 164 + + K NKK L+ Sbjct: 37990 NKKCLIEKKKNKKDLK 37943 Database: I.multifiliis_strain_G5/genome.fa Posted date: Nov 21, 2011 7:46 PM Number of letters in database: 48,799,969 Number of sequences in database: 2017 Lambda K H 0.311 0.131 0.380 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 6,183,887 Number of Sequences: 2017 Number of extensions: 60158 Number of successful extensions: 169 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 42 Number of HSP's successfully gapped in prelim test: 4 Number of HSP's that attempted gapping in prelim test: 122 Number of HSP's gapped (non-prelim): 54 length of query: 194 length of database: 16,266,656 effective HSP length: 97 effective length of query: 97 effective length of database: 16,071,007 effective search space: 1558887679 effective search space used: 1558887679 frameshift window, decay const: 40, 0.1 T: 13 A: 40 X1: 16 ( 7.2 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 42 (21.8 bits) S2: 59 (27.3 bits)