TBLASTN 2.2.13 [Nov-27-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= gi|315013579|ref|NP_001186661.1| selenoprotein S [Equus caballus] (190 letters) Database: I.multifiliis_strain_G5/genome.fa 2017 sequences; 48,799,969 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gi|340501382|gb|GL984282.1| Ichthyophthirius multifiliis unplace... 32 0.30 gi|340507794|gb|GL983394.1| Ichthyophthirius multifiliis unplace... 30 2.0 gi|340499430|gb|GL984923.1| Ichthyophthirius multifiliis unplace... 29 2.6 gi|340506687|gb|GL983575.1| Ichthyophthirius multifiliis unplace... 29 3.4 gi|340503888|gb|GL983999.1| Ichthyophthirius multifiliis unplace... 28 4.4 gi|340502432|gb|GL984181.1| Ichthyophthirius multifiliis unplace... 28 7.5 gi|340505945|gb|GL983752.1| Ichthyophthirius multifiliis unplace... 27 9.8 >gi|340501382|gb|GL984282.1| Ichthyophthirius multifiliis unplaced genomic scaffold scaff_1120509251321, whole genome shotgun sequence Length = 303348 Score = 32.3 bits (72), Expect = 0.30 Identities = 21/87 (24%), Positives = 39/87 (44%) Frame = +2 Query: 71 EPDVVVKRQEALAAARLKMQEELNAQVEKHKEKLRQLEEEKRRRKIEMWDSMQEGKSYKR 130 E ++ +++E + + +EE + EK KEK ++ EEE+ K + + +E K K Sbjct: 211271 EINIEEEKKEEEKEEKEEEEEEEENEKEKEKEKEKEKEEEEEEEKKKEEEKKEEEKEEKE 211450 Query: 131 NARGPQEEDSPGPSTSSVIPKRKSDRK 157 +E+ KRK +K Sbjct: 211451 EKEEKEEKKKKKKIEKKKKKKRKKKKK 211531 Score = 30.0 bits (66), Expect = 1.5 Identities = 22/109 (20%), Positives = 47/109 (43%) Frame = +1 Query: 49 QKLSSRLRALRQRRLDRAAAAVEPDVVVKRQEALAAARLKMQEELNAQVEKHKEKLRQLE 108 +K + + R+RR R KR++ + + +EE + EK KEK ++ E Sbjct: 211351 RKRKRKRKGKRRRRRRRKKKRRRKKRRRKRRKRRKRRKRRKEEEEENRKEKEKEKEKEEE 211530 Query: 109 EEKRRRKIEMWDSMQEGKSYKRNARGPQEEDSPGPSTSSVIPKRKSDRK 157 EE+ K ++ K K+ + +++ +++ K++ K Sbjct: 211531 EEEEEEKKNKKKKKKKNKKKKKKKKKKKKK*KKKKKKKTMMKKKRKKIK 211677 >gi|340507794|gb|GL983394.1| Ichthyophthirius multifiliis unplaced genomic scaffold scaff_1120509249958, whole genome shotgun sequence Length = 43560 Score = 29.6 bits (65), Expect = 2.0 Identities = 14/42 (33%), Positives = 28/42 (66%) Frame = +3 Query: 72 PDVVVKRQEALAAARLKMQEELNAQVEKHKEKLRQLEEEKRR 113 PD++ +QE + K + E N ++ KHKE++++ +EEK++ Sbjct: 28506 PDII--KQENIK----KKENEKNQELNKHKEEIKKNKEEKKK 28613 >gi|340499430|gb|GL984923.1| Ichthyophthirius multifiliis unplaced genomic scaffold scaff_5495, whole genome shotgun sequence Length = 1353 Score = 29.3 bits (64), Expect = 2.6 Identities = 13/51 (25%), Positives = 29/51 (56%) Frame = -3 Query: 88 KMQEELNAQVEKHKEKLRQLEEEKRRRKIEMWDSMQEGKSYKRNARGPQEE 138 +++ E ++EK KEK ++ E+EK + K + + +E + K + ++E Sbjct: 649 EIENEKENEIEKEKEKEKEKEKEKEKEKEKEKEKEKEKEKEKEKEKEKEKE 497 >gi|340506687|gb|GL983575.1| Ichthyophthirius multifiliis unplaced genomic scaffold scaff_1120509250386, whole genome shotgun sequence Length = 196347 Score = 28.9 bits (63), Expect = 3.4 Identities = 17/59 (28%), Positives = 33/59 (55%), Gaps = 2/59 (3%) Frame = +2 Query: 75 VVKRQEALAAARLKMQEELNAQVEKHKEKLRQLEEEKRRRKIEMWDSMQEG--KSYKRN 131 ++K ++ L + +++ + +E+ EKL LEE +RR+ E+ + M E + YK N Sbjct: 62603 LMKEKDLLESKCAEIKNDFEY*IEELNEKLCFLEENSKRREKEILE*MNENWEEKYKEN 62779 >gi|340503888|gb|GL983999.1| Ichthyophthirius multifiliis unplaced genomic scaffold scaff_1120509251036, whole genome shotgun sequence Length = 50548 Score = 28.5 bits (62), Expect = 4.4 Identities = 17/47 (36%), Positives = 28/47 (59%), Gaps = 1/47 (2%) Frame = -3 Query: 88 KMQEELNAQVEKH-KEKLRQLEEEKRRRKIEMWDSMQEGKSYKRNAR 133 K ++E+ + EK KEK + E+EKR ++ E ++ + K KRN R Sbjct: 38165 KREKEVKEKREKEVKEKREKEEKEKREKEEEEEETKGKRKKRKRNRR 38025 >gi|340502432|gb|GL984181.1| Ichthyophthirius multifiliis unplaced genomic scaffold scaff_1120509251220, whole genome shotgun sequence Length = 143409 Score = 27.7 bits (60), Expect = 7.5 Identities = 11/29 (37%), Positives = 20/29 (68%) Frame = +2 Query: 20 RFLHVTVGSLLAAYGWYLVFSCILLYVLF 48 RF + ++ S + +G+Y+ FS IL ++LF Sbjct: 139748 RFKYFSIRSTIN*FGFYISFSYILFFILF 139834 >gi|340505945|gb|GL983752.1| Ichthyophthirius multifiliis unplaced genomic scaffold scaff_1120509250730, whole genome shotgun sequence Length = 59055 Score = 27.3 bits (59), Expect = 9.8 Identities = 10/17 (58%), Positives = 14/17 (82%) Frame = +1 Query: 33 YGWYLVFSCILLYVLFQ 49 +G+++ FSCI LY LFQ Sbjct: 51394 FGFFI*FSCIFLYFLFQ 51444 Database: I.multifiliis_strain_G5/genome.fa Posted date: Nov 21, 2011 7:46 PM Number of letters in database: 48,799,969 Number of sequences in database: 2017 Lambda K H 0.315 0.133 0.386 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 5,779,856 Number of Sequences: 2017 Number of extensions: 57899 Number of successful extensions: 620 Number of sequences better than 10.0: 7 Number of HSP's better than 10.0 without gapping: 195 Number of HSP's successfully gapped in prelim test: 13 Number of HSP's that attempted gapping in prelim test: 370 Number of HSP's gapped (non-prelim): 302 length of query: 190 length of database: 16,266,656 effective HSP length: 97 effective length of query: 93 effective length of database: 16,071,007 effective search space: 1494603651 effective search space used: 1494603651 frameshift window, decay const: 40, 0.1 T: 13 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 42 (22.0 bits) S2: 59 (27.3 bits)