TBLASTN 2.2.13 [Nov-27-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= gi|168693663|ref|NP_001108229.1| selenoprotein S [Canis lupus familiaris] (190 letters) Database: I.multifiliis_strain_G5/genome.fa 2017 sequences; 48,799,969 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gi|340505964|gb|GL983749.1| Ichthyophthirius multifiliis unplace... 28 4.4 gi|340499430|gb|GL984923.1| Ichthyophthirius multifiliis unplace... 28 5.8 gi|340501357|gb|GL984285.1| Ichthyophthirius multifiliis unplace... 27 9.8 >gi|340505964|gb|GL983749.1| Ichthyophthirius multifiliis unplaced genomic scaffold scaff_1120509250725, whole genome shotgun sequence Length = 58153 Score = 28.5 bits (62), Expect = 4.4 Identities = 17/62 (27%), Positives = 37/62 (59%) Frame = +1 Query: 74 VVVKRQEALAAARLKMQEELNAQVEKHKEKLRQLEEQKRRQKIEMWDSMQEGKSYKGNAR 133 + +K+ + + KM+++L ++ KHK+K +Q ++ K RQK + + ++ + +K N Sbjct: 12508 IKIKK*KLKLKLKHKMKQKLKQKL-KHKQKQKQNKKNKLRQKKK*KNKQKQKQKHK-NKH 12681 Query: 134 KH 135 KH Sbjct: 12682 KH 12687 >gi|340499430|gb|GL984923.1| Ichthyophthirius multifiliis unplaced genomic scaffold scaff_5495, whole genome shotgun sequence Length = 1353 Score = 28.1 bits (61), Expect = 5.8 Identities = 12/51 (23%), Positives = 30/51 (58%) Frame = -3 Query: 88 KMQEELNAQVEKHKEKLRQLEEQKRRQKIEMWDSMQEGKSYKGNARKHPEE 138 +++ E ++EK KEK ++ E++K ++K + + +E + K ++ +E Sbjct: 649 EIENEKENEIEKEKEKEKEKEKEKEKEKEKEKEKEKEKEKEKEKEKEKEKE 497 >gi|340501357|gb|GL984285.1| Ichthyophthirius multifiliis unplaced genomic scaffold scaff_1120509251324, whole genome shotgun sequence Length = 66635 Score = 27.3 bits (59), Expect = 9.8 Identities = 12/26 (46%), Positives = 17/26 (65%) Frame = +3 Query: 19 LRYLHVTVGSLLATYGWYIVFSCILL 44 L YL++++G L T G +F CILL Sbjct: 13725 LIYLYISLGIYLMTLGVLFIFVCILL 13802 Database: I.multifiliis_strain_G5/genome.fa Posted date: Nov 21, 2011 7:46 PM Number of letters in database: 48,799,969 Number of sequences in database: 2017 Lambda K H 0.314 0.132 0.388 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 5,782,119 Number of Sequences: 2017 Number of extensions: 61812 Number of successful extensions: 509 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 140 Number of HSP's successfully gapped in prelim test: 14 Number of HSP's that attempted gapping in prelim test: 353 Number of HSP's gapped (non-prelim): 210 length of query: 190 length of database: 16,266,656 effective HSP length: 97 effective length of query: 93 effective length of database: 16,071,007 effective search space: 1494603651 effective search space used: 1494603651 frameshift window, decay const: 40, 0.1 T: 13 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 42 (22.0 bits) S2: 59 (27.3 bits)