TBLASTN 2.2.13 [Nov-27-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= gi|350646170|emb|CCD59154.1| Selenoprotein S [Schistosoma mansoni] (125 letters) Database: S.arctica/genome.fa 15,618 sequences; 121,588,341 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value supercont1.784 of Sphaeroforma arctica JP610 29 2.0 supercont1.885 of Sphaeroforma arctica JP610 29 2.6 supercont1.418 of Sphaeroforma arctica JP610 28 3.5 supercont1.2 of Sphaeroforma arctica JP610 28 4.5 supercont1.1205 of Sphaeroforma arctica JP610 28 5.9 supercont1.217 of Sphaeroforma arctica JP610 27 7.7 >supercont1.784 of Sphaeroforma arctica JP610 Length = 43128 Score = 29.3 bits (64), Expect = 2.0 Identities = 17/48 (35%), Positives = 29/48 (60%), Gaps = 1/48 (2%) Frame = +3 Query: 71 HKSRNQDE-GEGKSNVRKSTDSDEKKKRFRTSDYNPLMGDTGKTYRPT 117 ++ N+DE G+ K+ +RK D+D K K+ T + + + + KTY PT Sbjct: 28599 YEIENKDELGDRKTKIRK*QDNDNKYKQ*LTVNCSIIEYNHDKTYIPT 28742 >supercont1.885 of Sphaeroforma arctica JP610 Length = 33900 Score = 28.9 bits (63), Expect = 2.6 Identities = 19/61 (31%), Positives = 29/61 (47%) Frame = +1 Query: 40 NSSTVNNESHRLAMEAARAKFQAEFNAEVTQHKSRNQDEGEGKSNVRKSTDSDEKKKRFR 99 NS N+E+ + A A +E T H+S G+G SN RKS+ + K++ Sbjct: 25333 NSPEPNSENSHNPFQGNDALNVARKTSEETTHRS--DTNGDGSSNSRKSSKASYSKRKQA 25506 Query: 100 T 100 T Sbjct: 25507 T 25509 >supercont1.418 of Sphaeroforma arctica JP610 Length = 75699 Score = 28.5 bits (62), Expect = 3.5 Identities = 16/40 (40%), Positives = 20/40 (50%) Frame = -3 Query: 80 EGKSNVRKSTDSDEKKKRFRTSDYNPLMGDTGKTYRPTSR 119 EG KST++ K++ RT L GDTG Y T R Sbjct: 24976 EGSFGSAKSTETIHKRRYARTITSQALGGDTGGRYGSTIR 24857 >supercont1.2 of Sphaeroforma arctica JP610 Length = 348075 Score = 28.1 bits (61), Expect = 4.5 Identities = 15/50 (30%), Positives = 22/50 (44%) Frame = -3 Query: 70 QHKSRNQDEGEGKSNVRKSTDSDEKKKRFRTSDYNPLMGDTGKTYRPTSR 119 Q K + D + R+S S ++ T DYN L + G RP+ R Sbjct: 317251 QSKDKYTDSSSDDAVRRQSRQSRRRQSSIYTVDYNDLPDEQGNRTRPSRR 317102 >supercont1.1205 of Sphaeroforma arctica JP610 Length = 19738 Score = 27.7 bits (60), Expect = 5.9 Identities = 14/33 (42%), Positives = 19/33 (57%) Frame = -2 Query: 33 FFRSWCENSSTVNNESHRLAMEAARAKFQAEFN 65 FFRS E + N+ HR + + AKF+AE N Sbjct: 14409 FFRSAAEEMTVSNSRDHRFS-DNPMAKFEAEIN 14314 >supercont1.217 of Sphaeroforma arctica JP610 Length = 112121 Score = 27.3 bits (59), Expect = 7.7 Identities = 11/24 (45%), Positives = 15/24 (62%) Frame = +1 Query: 22 FIIALSYFLWKFFRSWCENSSTVN 45 F+IAL L+ F SW N S++N Sbjct: 90865 FVIALGKSLYNIFESWFTNKSSLN 90936 Database: S.arctica/genome.fa Posted date: Nov 21, 2011 7:47 PM Number of letters in database: 121,588,341 Number of sequences in database: 15,618 Lambda K H 0.315 0.129 0.386 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 15,411,392 Number of Sequences: 15618 Number of extensions: 167303 Number of successful extensions: 955 Number of sequences better than 10.0: 7 Number of HSP's better than 10.0 without gapping: 890 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 955 length of query: 125 length of database: 40,529,447 effective HSP length: 95 effective length of query: 30 effective length of database: 39,045,737 effective search space: 1171372110 effective search space used: 1171372110 frameshift window, decay const: 40, 0.1 T: 13 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.6 bits) S2: 58 (26.9 bits)