TBLASTN 2.2.13 [Nov-27-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= gi|33285002|ref|NP_060915.2| selenoprotein S [Homo sapiens] (189 letters) Database: I.multifiliis_strain_G5/genome.fa 2017 sequences; 48,799,969 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gi|340501382|gb|GL984282.1| Ichthyophthirius multifiliis unplace... 35 0.047 gi|340499430|gb|GL984923.1| Ichthyophthirius multifiliis unplace... 33 0.23 gi|340507794|gb|GL983394.1| Ichthyophthirius multifiliis unplace... 31 0.88 gi|340501650|gb|GL984247.1| Ichthyophthirius multifiliis unplace... 29 3.3 gi|340503888|gb|GL983999.1| Ichthyophthirius multifiliis unplace... 28 4.4 gi|340505964|gb|GL983749.1| Ichthyophthirius multifiliis unplace... 28 4.4 gi|340506843|gb|GL983551.1| Ichthyophthirius multifiliis unplace... 28 5.7 gi|340506985|gb|GL983521.1| Ichthyophthirius multifiliis unplace... 28 5.7 gi|340505486|gb|GL983812.1| Ichthyophthirius multifiliis unplace... 28 7.4 gi|340507744|gb|GL983410.1| Ichthyophthirius multifiliis unplace... 27 9.7 >gi|340501382|gb|GL984282.1| Ichthyophthirius multifiliis unplaced genomic scaffold scaff_1120509251321, whole genome shotgun sequence Length = 303348 Score = 35.0 bits (79), Expect = 0.047 Identities = 20/76 (26%), Positives = 38/76 (50%) Frame = +1 Query: 77 KRQEALAAARLKMQEELNAQVEKHKEKLKQLEEEKRRQKIEMWDSMQEGKSYKGNAKKPQ 136 KR++ + + +EE + EK KEK K+ EEE+ +K ++ K K KK + Sbjct: 211435 KRRKRRKRRKRRKEEEEENRKEKEKEKEKEEEEEEEEEKKNKKKKKKKNKKKKKKKKKKK 211614 Query: 137 EEDSPGPSTSSVLKRK 152 ++ +++K+K Sbjct: 211615 KK*KKKKKKKTMMKKK 211662 Score = 33.9 bits (76), Expect = 0.10 Identities = 23/86 (26%), Positives = 42/86 (48%) Frame = +2 Query: 71 EPDVVVKRQEALAAARLKMQEELNAQVEKHKEKLKQLEEEKRRQKIEMWDSMQEGKSYKG 130 E ++ +++E + + +EE + EK KEK K+ EEE+ +K + + +E K K Sbjct: 211271 EINIEEEKKEEEKEEKEEEEEEEENEKEKEKEKEKEKEEEEEEEKKKEEEKKEEEKEEK- 211447 Query: 131 NAKKPQEEDSPGPSTSSVLKRKSDRK 156 K+ +EE K+K +K Sbjct: 211448 EEKEEKEEKKKKKKIEKKKKKKRKKK 211525 Score = 30.4 bits (67), Expect = 1.1 Identities = 21/72 (29%), Positives = 34/72 (47%), Gaps = 2/72 (2%) Frame = +2 Query: 90 QEELNAQVEKHKEKLKQLEEEKRR--QKIEMWDSMQEGKSYKGNAKKPQEEDSPGPSTSS 147 + E + EK KEK ++ EEEK++ +K E +E K K KK ++ + Sbjct: 211340 ENEKEKEKEKEKEKEEEEEEEKKKEEEKKEEEKEEKEEKEEKEEKKKKKKIEKKKKKKRK 211519 Query: 148 VLKRKSDRKPLR 159 K+K +K R Sbjct: 211520 KKKKKKKKKKKR 211555 Score = 29.3 bits (64), Expect = 2.6 Identities = 19/83 (22%), Positives = 37/83 (44%) Frame = +1 Query: 77 KRQEALAAARLKMQEELNAQVEKHKEKLKQLEEEKRRQKIEMWDSMQEGKSYKGNAKKPQ 136 +R+ R K ++E + K KEK K+ EEE+ ++ + ++ K+ K KK + Sbjct: 211429 RRKRRKRRKRRKRRKEEEEENRKEKEKEKEKEEEEEEEEEKKNKKKKKKKNKKKKKKKKK 211608 Query: 137 EEDSPGPSTSSVLKRKSDRKPLR 159 ++ K RK ++ Sbjct: 211609 KKKK*KKKKKKKTMMKKKRKKIK 211677 Score = 28.5 bits (62), Expect = 4.4 Identities = 18/74 (24%), Positives = 35/74 (47%), Gaps = 9/74 (12%) Frame = +2 Query: 91 EELNAQVEKHKEKLKQLEE---------EKRRQKIEMWDSMQEGKSYKGNAKKPQEEDSP 141 EE+N + EK +E+ ++ EE EK ++K + + +E + K KK +E++ Sbjct: 211268 EEINIEEEKKEEEKEEKEEEEEEEENEKEKEKEKEKEKEEEEEEEKKKEEEKKEEEKEEK 211447 Query: 142 GPSTSSVLKRKSDR 155 K+K + Sbjct: 211448 EEKEEKEEKKKKKK 211489 >gi|340499430|gb|GL984923.1| Ichthyophthirius multifiliis unplaced genomic scaffold scaff_5495, whole genome shotgun sequence Length = 1353 Score = 32.7 bits (73), Expect = 0.23 Identities = 15/51 (29%), Positives = 31/51 (60%) Frame = -3 Query: 88 KMQEELNAQVEKHKEKLKQLEEEKRRQKIEMWDSMQEGKSYKGNAKKPQEE 138 +++ E ++EK KEK K+ E+EK ++K + + +E + K K+ ++E Sbjct: 649 EIENEKENEIEKEKEKEKEKEKEKEKEKEKEKEKEKEKEKEKEKEKEKEKE 497 >gi|340507794|gb|GL983394.1| Ichthyophthirius multifiliis unplaced genomic scaffold scaff_1120509249958, whole genome shotgun sequence Length = 43560 Score = 30.8 bits (68), Expect = 0.88 Identities = 15/42 (35%), Positives = 28/42 (66%) Frame = +3 Query: 72 PDVVVKRQEALAAARLKMQEELNAQVEKHKEKLKQLEEEKRR 113 PD++ +QE + K + E N ++ KHKE++K+ +EEK++ Sbjct: 28506 PDII--KQENIK----KKENEKNQELNKHKEEIKKNKEEKKK 28613 >gi|340501650|gb|GL984247.1| Ichthyophthirius multifiliis unplaced genomic scaffold scaff_1120509251286, whole genome shotgun sequence Length = 122534 Score = 28.9 bits (63), Expect = 3.3 Identities = 19/78 (24%), Positives = 44/78 (56%), Gaps = 6/78 (7%) Frame = -2 Query: 88 KMQEELNAQVEKHKEKLKQLEE--EKRRQKIEMWDSMQEGKSYKGNAKKPQE----EDSP 141 K +E+ + +KEK K ++ EK+++K ++ D ++GKS K +K + ++ Sbjct: 38170 KKKEDKKKNKKNYKEKKKNKKDLKEKKKKKKDLKD--KKGKSKKDLKEKKKNKKDLKEKK 37997 Query: 142 GPSTSSVLKRKSDRKPLR 159 G + ++++K ++K L+ Sbjct: 37996 GKNKKCLIEKKKNKKDLK 37943 >gi|340503888|gb|GL983999.1| Ichthyophthirius multifiliis unplaced genomic scaffold scaff_1120509251036, whole genome shotgun sequence Length = 50548 Score = 28.5 bits (62), Expect = 4.4 Identities = 17/51 (33%), Positives = 27/51 (52%), Gaps = 10/51 (19%) Frame = -1 Query: 77 KRQEALAAARLKMQEELNAQVEKHKE----------KLKQLEEEKRRQKIE 117 +++E R K +EE + E+ KE K++Q EEE++RQK E Sbjct: 37597 RKEEEEEEMRQKEEEEKRKEQERRKEEEEMRLK*EEKMRQKEEEEKRQKEE 37445 Score = 27.3 bits (59), Expect = 9.7 Identities = 18/69 (26%), Positives = 34/69 (49%) Frame = -3 Query: 88 KMQEELNAQVEKHKEKLKQLEEEKRRQKIEMWDSMQEGKSYKGNAKKPQEEDSPGPSTSS 147 K QEE + ++ +EK ++ EEEK R+K E +E + + ++ +EE+ Sbjct: 38582 KKQEEKEKKEKEEEEKREKEEEEK*REKEE-----KERREIEEKERREKEEEREKEKEEK 38418 Query: 148 VLKRKSDRK 156 K K + + Sbjct: 38417 *KKEKEEEE 38391 >gi|340505964|gb|GL983749.1| Ichthyophthirius multifiliis unplaced genomic scaffold scaff_1120509250725, whole genome shotgun sequence Length = 58153 Score = 28.5 bits (62), Expect = 4.4 Identities = 16/60 (26%), Positives = 35/60 (58%) Frame = +1 Query: 74 VVVKRQEALAAARLKMQEELNAQVEKHKEKLKQLEEEKRRQKIEMWDSMQEGKSYKGNAK 133 + +K+ + + KM+++L ++ KHK+K KQ ++ K RQK + + ++ + +K K Sbjct: 12508 IKIKK*KLKLKLKHKMKQKLKQKL-KHKQKQKQNKKNKLRQKKK*KNKQKQKQKHKNKHK 12684 >gi|340506843|gb|GL983551.1| Ichthyophthirius multifiliis unplaced genomic scaffold scaff_1120509250345, whole genome shotgun sequence Length = 63840 Score = 28.1 bits (61), Expect = 5.7 Identities = 20/57 (35%), Positives = 32/57 (56%), Gaps = 1/57 (1%) Frame = +1 Query: 82 LAAARLKMQEELNAQVEKHKEKLKQLEEEKRRQK-IEMWDSMQEGKSYKGNAKKPQE 137 LAA RLK EE + K +++ K+ EEE+ R + +E+ +E K K K+ +E Sbjct: 45430 LAAERLKKIEEEKLEQ*KLEDE*KR*EEEEERMR*LEISKQEEEKKKKKDEKKRLKE 45600 >gi|340506985|gb|GL983521.1| Ichthyophthirius multifiliis unplaced genomic scaffold scaff_1120509250296, whole genome shotgun sequence Length = 79067 Score = 28.1 bits (61), Expect = 5.7 Identities = 18/51 (35%), Positives = 28/51 (54%) Frame = +1 Query: 88 KMQEELNAQVEKHKEKLKQLEEEKRRQKIEMWDSMQEGKSYKGNAKKPQEE 138 K QEE Q EK++EK ++ +EEK + E ++ K + K+ QEE Sbjct: 46576 KKQEE--NQEEKYEEKQEENKEEK*EENQEEKQKKKQEKKQEEKQKEKQEE 46722 >gi|340505486|gb|GL983812.1| Ichthyophthirius multifiliis unplaced genomic scaffold scaff_1120509250848, whole genome shotgun sequence Length = 184484 Score = 27.7 bits (60), Expect = 7.4 Identities = 20/64 (31%), Positives = 34/64 (53%), Gaps = 3/64 (4%) Frame = -3 Query: 77 KRQEALAAARLKMQEELNAQ--VEKHKEKLKQLEEEKRRQ-KIEMWDSMQEGKSYKGNAK 133 K++E + + +EE N + EK+KEK EEK+ + K E + +E K + N + Sbjct: 121119 KKEEKKEEKKEEKKEEKNEENLEEKNKEKKGDKNEEKKEEKKEEKKEEKKEEKKEEKNEE 120940 Query: 134 KPQE 137 K +E Sbjct: 120939 KNKE 120928 >gi|340507744|gb|GL983410.1| Ichthyophthirius multifiliis unplaced genomic scaffold scaff_1120509250066, whole genome shotgun sequence Length = 28596 Score = 27.3 bits (59), Expect = 9.7 Identities = 19/76 (25%), Positives = 37/76 (48%), Gaps = 5/76 (6%) Frame = +3 Query: 86 RLKMQEELNAQVEKHKEKLKQLEEEKRRQKIEMWDSMQ-----EGKSYKGNAKKPQEEDS 140 +++ +EE + K+ +++ EEK+ +KIE + + E K K KK +++D Sbjct: 8313 KVEKKEEKK*EKTIEKKTIEKKREEKKHEKIEKKNEKKQENTIEKKEIKKEVKKDEKKDE 8492 Query: 141 PGPSTSSVLKRKSDRK 156 K+K D+K Sbjct: 8493 KKDD-----KKKDDKK 8525 Database: I.multifiliis_strain_G5/genome.fa Posted date: Nov 21, 2011 7:46 PM Number of letters in database: 48,799,969 Number of sequences in database: 2017 Lambda K H 0.313 0.130 0.373 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 5,503,515 Number of Sequences: 2017 Number of extensions: 53674 Number of successful extensions: 527 Number of sequences better than 10.0: 10 Number of HSP's better than 10.0 without gapping: 160 Number of HSP's successfully gapped in prelim test: 16 Number of HSP's that attempted gapping in prelim test: 325 Number of HSP's gapped (non-prelim): 252 length of query: 189 length of database: 16,266,656 effective HSP length: 97 effective length of query: 92 effective length of database: 16,071,007 effective search space: 1478532644 effective search space used: 1478532644 frameshift window, decay const: 40, 0.1 T: 13 A: 40 X1: 16 ( 7.2 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 42 (21.9 bits) S2: 59 (27.3 bits)