TBLASTN 2.2.13 [Nov-27-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Danio rerio (151 letters) Database: P.polycephalum/genome.fa 297,657 sequences; 319,018,052 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Contig9047 4369 10313 31 2.2 Contig2630 13504 31540 29 6.3 >Contig9047 4369 10313 Length = 10313 Score = 30.8 bits (68), Expect = 2.2 Identities = 16/42 (38%), Positives = 18/42 (42%) Frame = -3 Query: 110 PEDQVPEEFRFSPAKDSPFEGRQSSTAAPETTEPSDSQHTDL 151 P P SP+ SP SS TTEPSD Q D+ Sbjct: 10167 PPSSSPSPSSPSPSSPSPSSPSPSSATPSSTTEPSDDQSNDV 10042 >Contig2630 13504 31540 Length = 31540 Score = 29.3 bits (64), Expect = 6.3 Identities = 14/37 (37%), Positives = 22/37 (59%) Frame = -2 Query: 71 ELVLLNHYYEELDRIPLSEMTRAEINKLLAELGFYKK 107 EL++L + YEE R ++ + + E KL+ E YKK Sbjct: 6531 ELLILRNIYEEKSR*MINNVNKKETQKLIEEKEDYKK 6421 Database: P.polycephalum/genome.fa Posted date: Nov 21, 2011 7:46 PM Number of letters in database: 319,018,052 Number of sequences in database: 297,657 Lambda K H 0.317 0.135 0.393 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 49,570,129 Number of Sequences: 297657 Number of extensions: 589193 Number of successful extensions: 4137 Number of sequences better than 10.0: 4 Number of HSP's better than 10.0 without gapping: 4082 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 4137 length of query: 151 length of database: 106,339,350 effective HSP length: 103 effective length of query: 48 effective length of database: 75,680,679 effective search space: 3632672592 effective search space used: 3632672592 frameshift window, decay const: 40, 0.1 T: 13 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.6 bits) S2: 62 (28.5 bits)