TBLASTN 2.2.13 [Nov-27-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Danio rerio (151 letters) Database: D.fasciculatum/genome.fa 25 sequences; 31,019,208 total letters Searching.........................done Score E Sequences producing significant alignments: (bits) Value gi|328869808|gb|GL883018.1| Dictyostelium fasciculatum unplaced ... 28 2.4 gi|328871378|gb|GL883013.1| Dictyostelium fasciculatum unplaced ... 28 3.1 gi|328876102|gb|GL883006.1| Dictyostelium fasciculatum unplaced ... 27 4.1 >gi|328869808|gb|GL883018.1| Dictyostelium fasciculatum unplaced genomic scaffold Scf_Dfasci-G-b-285a01.f1-5, whole genome shotgun sequence Length = 1327167 Score = 28.1 bits (61), Expect = 2.4 Identities = 18/59 (30%), Positives = 28/59 (47%) Frame = -2 Query: 6 FTALLPSVILTYEVNIEKLSGLARARVETCGGXQLNRMREVKAFVTQDIPLYHNLVMKH 64 F L+ + +E++ E L G R VE GG L ++ +V + NLV+KH Sbjct: 991274 FQQLVDLGLSEFEISDETLKGWTR--VERVGGDVLGHSVGIQGWVVDRVE*VSNLVLKH 991104 >gi|328871378|gb|GL883013.1| Dictyostelium fasciculatum unplaced genomic scaffold Scf_ET2XIPL01CNAVH-3, whole genome shotgun sequence Length = 1908399 Score = 27.7 bits (60), Expect = 3.1 Identities = 11/32 (34%), Positives = 19/32 (59%) Frame = +1 Query: 3 PLIFTALLPSVILTYEVNIEKLSGLARARVET 34 P+ ++PS + T E+N+E ++G VET Sbjct: 1226467 PVFDLGIIPSTVKTLELNVEDITGTLTDSVET 1226562 >gi|328876102|gb|GL883006.1| Dictyostelium fasciculatum unplaced genomic scaffold Scf_Dfasci-G-b-205a01.r1-3, whole genome shotgun sequence Length = 2485436 Score = 27.3 bits (59), Expect = 4.1 Identities = 16/43 (37%), Positives = 21/43 (48%), Gaps = 2/43 (4%) Frame = +1 Query: 106 KKDHPEDQVPEEFRFSPAKDSPFEGRQS--STAAPETTEPSDS 146 +K+H + E SP +D P G S ST +P TT DS Sbjct: 1561468 RKEHKDSPAVETNNKSPLRDQPAAGGDSPVSTNSPTTTTNYDS 1561596 Database: D.fasciculatum/genome.fa Posted date: Nov 21, 2011 7:46 PM Number of letters in database: 31,019,208 Number of sequences in database: 25 Lambda K H 0.317 0.135 0.393 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 4,718,286 Number of Sequences: 25 Number of extensions: 61463 Number of successful extensions: 255 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 1 Number of HSP's successfully gapped in prelim test: 2 Number of HSP's that attempted gapping in prelim test: 244 Number of HSP's gapped (non-prelim): 28 length of query: 151 length of database: 10,339,736 effective HSP length: 91 effective length of query: 60 effective length of database: 10,337,461 effective search space: 620247660 effective search space used: 620247660 frameshift window, decay const: 40, 0.1 T: 13 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.6 bits) S2: 56 (26.2 bits)