TBLASTN 2.2.13 [Nov-27-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Danio rerio (151 letters) Database: D.discoideum_AX4/genome.fa 6 sequences; 33,943,072 total letters Searching......done Score E Sequences producing significant alignments: (bits) Value gi|93569114|gb|CM000150.2| Dictyostelium discoideum AX4 chromoso... 30 0.53 gi|93569080|gb|CM000153.2| Dictyostelium discoideum AX4 chromoso... 29 1.5 gi|93569058|gb|CM000155.2| Dictyostelium discoideum AX4 chromoso... 28 2.6 gi|93569092|gb|CM000152.2| Dictyostelium discoideum AX4 chromoso... 27 7.6 gi|256541943|gb|CM000151.3| Dictyostelium discoideum AX4 chromos... 26 9.9 >gi|93569114|gb|CM000150.2| Dictyostelium discoideum AX4 chromosome 1, whole genome shotgun sequence Length = 4923596 Score = 30.4 bits (67), Expect = 0.53 Identities = 14/37 (37%), Positives = 23/37 (62%) Frame = +2 Query: 70 PELVLLNHYYEELDRIPLSEMTRAEINKLLAELGFYK 106 P L+ + +YY LD++ + E A +N+ L +L FYK Sbjct: 1615997 PLLLTIINYYYLLDQLNIHEYNEAYLNQPLMKLNFYK 1616107 >gi|93569080|gb|CM000153.2| Dictyostelium discoideum AX4 chromosome 4, whole genome shotgun sequence Length = 5450249 Score = 28.9 bits (63), Expect = 1.5 Identities = 8/28 (28%), Positives = 20/28 (71%) Frame = -3 Query: 76 NHYYEELDRIPLSEMTRAEINKLLAELG 103 NHY+ + DR+P++ + A++++ + + G Sbjct: 2612187 NHYFSDFDRLPIAAASLAQVHRAITKEG 2612104 Score = 27.3 bits (59), Expect = 4.5 Identities = 14/43 (32%), Positives = 24/43 (55%), Gaps = 1/43 (2%) Frame = -1 Query: 106 KKDHPEDQVPEEFRF-SPAKDSPFEGRQSSTAAPETTEPSDSQ 147 +KDHP+D + +EF P KD + ++S+ P+ + D Q Sbjct: 1212530 EKDHPKDHIFKEFIIDEPMKDG--DEKESTNEPPQQQKQQDQQ 1212408 Score = 26.2 bits (56), Expect = 9.9 Identities = 16/38 (42%), Positives = 19/38 (50%), Gaps = 2/38 (5%) Frame = +3 Query: 74 LLNHYYEELD--RIPLSEMTRAEINKLLAELGFYKKDH 109 LLNH YEEL L + + KL+ L YK DH Sbjct: 1198542 LLNHLYEELQLKYEELDLVVHLILYKLVVHLVLYKLDH 1198655 >gi|93569058|gb|CM000155.2| Dictyostelium discoideum AX4 chromosome 6, whole genome shotgun sequence Length = 3602379 Score = 28.1 bits (61), Expect = 2.6 Identities = 10/24 (41%), Positives = 16/24 (66%) Frame = -3 Query: 56 LYHNLVMKHIPGADPELVLLNHYY 79 L+H+L+ HI D + + LN+YY Sbjct: 1074112 LFHSLISNHIKSVDLDYLHLNYYY 1074041 >gi|93569092|gb|CM000152.2| Dictyostelium discoideum AX4 chromosome 3, whole genome shotgun sequence Length = 6357299 Score = 26.6 bits (57), Expect = 7.6 Identities = 15/39 (38%), Positives = 24/39 (61%), Gaps = 1/39 (2%) Frame = -1 Query: 46 VKAFVTQDIPLYHNLVMKHIPGADPELVLLNH-YYEELD 83 V F+ D P NL+++ P P+LVLL+H Y+++D Sbjct: 4694366 VHGFLHSD-PHPGNLLVRKTPNGKPDLVLLDHGLYKKID 4694253 Score = 26.2 bits (56), Expect = 9.9 Identities = 12/35 (34%), Positives = 23/35 (65%) Frame = +2 Query: 73 VLLNHYYEELDRIPLSEMTRAEINKLLAELGFYKK 107 ++LNHY++E+ +I L M + KLL+ + + K+ Sbjct: 5235329 MILNHYHQEVMKIQLKLMNQRI*LKLLSNMKWKKR 5235433 >gi|256541943|gb|CM000151.3| Dictyostelium discoideum AX4 chromosome 2, whole genome shotgun sequence Length = 8484197 Score = 26.2 bits (56), Expect = 9.9 Identities = 19/81 (23%), Positives = 41/81 (50%), Gaps = 2/81 (2%) Frame = -2 Query: 24 LSGLARARVETCGGXQLNRMREVKAFVTQDIPLYHNLVMKHIPGADPELVLLNHYYEELD 83 L+ + R+ET +E + ++I L H ++++ + + Y+E L Sbjct: 7377955 LNSNSSTRLETLNYLIETFKKETNKSINKEIELSHEVLLQSL-----DSTCEIEYHERLF 7377791 Query: 84 RIPLSEMTRAEIN--KLLAEL 102 ++ L+++ R+EIN +LL +L Sbjct: 7377790 KLCLNDLKRSEINIARLLGKL 7377728 Database: D.discoideum_AX4/genome.fa Posted date: Nov 21, 2011 7:46 PM Number of letters in database: 33,943,072 Number of sequences in database: 6 Lambda K H 0.317 0.135 0.393 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 4,915,544 Number of Sequences: 6 Number of extensions: 70534 Number of successful extensions: 241 Number of sequences better than 10.0: 5 Number of HSP's better than 10.0 without gapping: 4 Number of HSP's successfully gapped in prelim test: 4 Number of HSP's that attempted gapping in prelim test: 197 Number of HSP's gapped (non-prelim): 170 length of query: 151 length of database: 11,314,357 effective HSP length: 91 effective length of query: 60 effective length of database: 11,313,811 effective search space: 678828660 effective search space used: 678828660 frameshift window, decay const: 40, 0.1 T: 13 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.6 bits) S2: 56 (26.2 bits)