TBLASTN 2.2.13 [Nov-27-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Chlamydomonas reinhardtii 2 (138 letters) Database: D.fasciculatum/genome.fa 25 sequences; 31,019,208 total letters Searching.........................done Score E Sequences producing significant alignments: (bits) Value gi|328867405|gb|GL883025.1| Dictyostelium fasciculatum unplaced ... 32 0.18 gi|328874319|gb|GL883008.1| Dictyostelium fasciculatum unplaced ... 30 0.51 gi|328864870|gb|GL883029.1| Dictyostelium fasciculatum unplaced ... 27 3.3 gi|328871378|gb|GL883013.1| Dictyostelium fasciculatum unplaced ... 27 4.3 gi|328873752|gb|GL883009.1| Dictyostelium fasciculatum unplaced ... 27 4.3 gi|328872098|gb|GL883010.1| Dictyostelium fasciculatum unplaced ... 26 9.7 >gi|328867405|gb|GL883025.1| Dictyostelium fasciculatum unplaced genomic scaffold Scf_EU5ZYIE01EUG8B-5, whole genome shotgun sequence Length = 941765 Score = 31.6 bits (70), Expect = 0.18 Identities = 25/79 (31%), Positives = 35/79 (44%), Gaps = 6/79 (7%) Frame = +1 Query: 24 RGEFISCPGXRLNHLPEVKKFIRGDIEKDKAYENLTVNFVPGRTPELVLYDEN------G 77 RGE ++ G +N P +KK G +T + V +VL D+N G Sbjct: 911446 RGEIVAVTGDGVNDSPALKKADLG------CAMGITGSEVAKEAAAIVLLDDNFSSIVSG 911607 Query: 78 VEIERMFVDKLKYDELHTL 96 +E RM DKLK +TL Sbjct: 911608 IEEGRMIFDKLKKSITYTL 911664 >gi|328874319|gb|GL883008.1| Dictyostelium fasciculatum unplaced genomic scaffold Scf_Dfasci-G-o-80e12.f1-5, whole genome shotgun sequence Length = 2750715 Score = 30.0 bits (66), Expect = 0.51 Identities = 17/42 (40%), Positives = 24/42 (57%), Gaps = 1/42 (2%) Frame = -3 Query: 93 LHTLVQ-SKGFKRRDPNAAAATTTATASTRRARAARRLLRAT 133 +HTL+ S GF+R TTT +STR + R+LR+T Sbjct: 2545291 IHTLID*SNGFRR----TTTTTTTNVSSTRTTSSTTRILRST 2545178 >gi|328864870|gb|GL883029.1| Dictyostelium fasciculatum unplaced genomic scaffold Scf_EUAJFUG02HR96I-5, whole genome shotgun sequence Length = 3408800 Score = 27.3 bits (59), Expect = 3.3 Identities = 13/28 (46%), Positives = 17/28 (60%) Frame = +3 Query: 95 TLVQSKGFKRRDPNAAAATTTATASTRR 122 T+ Q+KG K + N + TTT T TRR Sbjct: 2797722 TITQNKG*KEKTRN*SCTTTTTTTWTRR 2797805 >gi|328871378|gb|GL883013.1| Dictyostelium fasciculatum unplaced genomic scaffold Scf_ET2XIPL01CNAVH-3, whole genome shotgun sequence Length = 1908399 Score = 26.9 bits (58), Expect = 4.3 Identities = 12/46 (26%), Positives = 23/46 (50%) Frame = -2 Query: 55 YENLTVNFVPGRTPELVLYDENGVEIERMFVDKLKYDELHTLVQSK 100 Y+N+ ++ VPGR P ++ + + +K+D+L V K Sbjct: 286973 YDNVDIDDVPGREPPAYVHLRTSAGLRSNIGNDIKFDKLTLSVPGK 286836 >gi|328873752|gb|GL883009.1| Dictyostelium fasciculatum unplaced genomic scaffold Scf_Dfasci-G-o-33e01.r1-3, whole genome shotgun sequence Length = 1429294 Score = 26.9 bits (58), Expect = 4.3 Identities = 14/30 (46%), Positives = 16/30 (53%) Frame = -2 Query: 107 PNAAAATTTATASTRRARAARRLLRATEET 136 P AAA TTT T +T R+ R R T T Sbjct: 269553 PAAAATTTTTTTTTARSTTTTRPTRPTYTT 269464 >gi|328872098|gb|GL883010.1| Dictyostelium fasciculatum unplaced genomic scaffold Scf_Dfasci-F-a-25c12.r2-5, whole genome shotgun sequence Length = 4166812 Score = 25.8 bits (55), Expect = 9.7 Identities = 15/33 (45%), Positives = 17/33 (51%) Frame = -3 Query: 101 GFKRRDPNAAAATTTATASTRRARAARRLLRAT 133 G R AAATTTA A+TR + R AT Sbjct: 3123980 GATTRPSTTAAATTTAGATTRPSTTGRPTSAAT 3123882 Score = 25.8 bits (55), Expect = 9.7 Identities = 11/15 (73%), Positives = 11/15 (73%) Frame = -2 Query: 101 GFKRRDPNAAAATTT 115 GF RD N AAATTT Sbjct: 158073 GFNNRDSNTAAATTT 158029 Database: D.fasciculatum/genome.fa Posted date: Nov 21, 2011 7:46 PM Number of letters in database: 31,019,208 Number of sequences in database: 25 Lambda K H 0.320 0.133 0.369 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 2,925,126 Number of Sequences: 25 Number of extensions: 29859 Number of successful extensions: 254 Number of sequences better than 10.0: 6 Number of HSP's better than 10.0 without gapping: 5 Number of HSP's successfully gapped in prelim test: 2 Number of HSP's that attempted gapping in prelim test: 229 Number of HSP's gapped (non-prelim): 78 length of query: 138 length of database: 10,339,736 effective HSP length: 89 effective length of query: 49 effective length of database: 10,337,511 effective search space: 506538039 effective search space used: 506538039 frameshift window, decay const: 40, 0.1 T: 13 A: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 55 (25.8 bits)