TBLASTN 2.2.13 [Nov-27-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Chlamydomonas reinhardtii 1 (140 letters) Database: L.tarentolae/genome.fa 7267 sequences; 31,598,840 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Lt_contig5330 | | 1 to 14026 28 1.5 Lt_contig4734 | | 1 to 4767 28 2.5 Lt_contig275 | | 1 to 10127 28 2.5 Lt_contig6003 | | 1 to 10172 27 3.3 Lt_contig5929 | | 1 to 23817 27 5.6 Lt_contig5807 | | 1 to 8589 27 5.6 Lt_contig5135 | | 1 to 5368 26 7.4 >Lt_contig5330 | | 1 to 14026 Length = 14026 Score = 28.5 bits (62), Expect = 1.5 Identities = 17/39 (43%), Positives = 22/39 (56%), Gaps = 1/39 (2%) Frame = +2 Query: 6 LASLLLLLTVAGAAAQ-EAASAPAYELNEAGQRMVFISC 43 LA+ L T +GAAA +AASA A E A +F +C Sbjct: 3893 LANCLRSATASGAAAAIQAASAQAAEATHAASEEIFFTC 4009 >Lt_contig4734 | | 1 to 4767 Length = 4767 Score = 27.7 bits (60), Expect = 2.5 Identities = 10/31 (32%), Positives = 20/31 (64%) Frame = -1 Query: 19 AAQEAASAPAYELNEAGQRMVFISCSGXRLK 49 +A ++ + Y ++++GQR+ +SCS R K Sbjct: 2865 SAASSSFSAVYNISQSGQRLAIVSCSWPRSK 2773 >Lt_contig275 | | 1 to 10127 Length = 10127 Score = 27.7 bits (60), Expect = 2.5 Identities = 12/27 (44%), Positives = 19/27 (70%) Frame = -3 Query: 2 RFPTLASLLLLLTVAGAAAQEAASAPA 28 RFP + +LLL+L +AG A ++ AP+ Sbjct: 246 RFPRVPTLLLVLVLAG*AVRDVEGAPS 166 >Lt_contig6003 | | 1 to 10172 Length = 10172 Score = 27.3 bits (59), Expect = 3.3 Identities = 18/35 (51%), Positives = 21/35 (60%), Gaps = 1/35 (2%) Frame = -1 Query: 2 RFPTLASLLLLLTVAGAAAQEAASAPAYE-LNEAG 35 RFP L L L+VAG A+ + PA E LNEAG Sbjct: 6842 RFPALFP-SLKLSVAGGCAERSVGVPAGEFLNEAG 6741 >Lt_contig5929 | | 1 to 23817 Length = 23817 Score = 26.6 bits (57), Expect = 5.6 Identities = 15/39 (38%), Positives = 21/39 (53%) Frame = -3 Query: 2 RFPTLASLLLLLTVAGAAAQEAASAPAYELNEAGQRMVF 40 R PT+ ++LLLL V +++AS E E G VF Sbjct: 12508 RDPTVVAMLLLLHVVRTEKRKSASVGVKEAGERGT*TVF 12392 >Lt_contig5807 | | 1 to 8589 Length = 8589 Score = 26.6 bits (57), Expect = 5.6 Identities = 13/45 (28%), Positives = 19/45 (42%) Frame = +3 Query: 52 PEVKRFLYDVVRPNLYHGVTVDFTPGRSPAAYLYDADNQLVDDGY 96 P + LYD+ + + T PG S A +A +D GY Sbjct: 7533 PRLSALLYDMDDDEVVNDATASSAPGESATAATDNAAQHHIDPGY 7667 >Lt_contig5135 | | 1 to 5368 Length = 5368 Score = 26.2 bits (56), Expect = 7.4 Identities = 13/25 (52%), Positives = 15/25 (60%) Frame = -2 Query: 13 LTVAGAAAQEAASAPAYELNEAGQR 37 L AGA+A A SAPAYE +R Sbjct: 4056 LLAAGASAGSALSAPAYEAAGGSER 3982 Database: L.tarentolae/genome.fa Posted date: Nov 21, 2011 7:46 PM Number of letters in database: 31,598,840 Number of sequences in database: 7267 Lambda K H 0.319 0.135 0.393 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 4,762,661 Number of Sequences: 7267 Number of extensions: 64586 Number of successful extensions: 330 Number of sequences better than 10.0: 7 Number of HSP's better than 10.0 without gapping: 325 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 330 length of query: 140 length of database: 10,532,946 effective HSP length: 89 effective length of query: 51 effective length of database: 9,886,183 effective search space: 504195333 effective search space used: 504195333 frameshift window, decay const: 40, 0.1 T: 13 A: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 55 (25.8 bits)