TBLASTN 2.2.13 [Nov-27-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Chlamydomonas reinhardtii 1 (140 letters) Database: L.donovani_BPK282A1/genome.fa 36 sequences; 32,444,998 total letters Searching....................................done Score E Sequences producing significant alignments: (bits) Value contig_09 30 0.71 contig_15 27 3.5 contig_21 26 7.9 >contig_09 Length = 588727 Score = 29.6 bits (65), Expect = 0.71 Identities = 15/37 (40%), Positives = 22/37 (59%) Frame = -3 Query: 8 SLLLLLTVAGAAAQEAASAPAYELNEAGQRMVFISCS 44 S+L +T AA AA+AP + EAG +++ SCS Sbjct: 262190 SMLACVTAVAVAAAVAAAAPCGTIKEAGWKVLRRSCS 262080 >contig_15 Length = 618357 Score = 27.3 bits (59), Expect = 3.5 Identities = 14/26 (53%), Positives = 18/26 (69%) Frame = -2 Query: 4 PTLASLLLLLTVAGAAAQEAASAPAY 29 PTL+S L LLT+ A Q+AA+ AY Sbjct: 76589 PTLSSSLWLLTMETLAHQDAAAVDAY 76512 >contig_21 Length = 767234 Score = 26.2 bits (56), Expect = 7.9 Identities = 25/86 (29%), Positives = 35/86 (40%), Gaps = 11/86 (12%) Frame = +3 Query: 21 QEAASAPAYELNEAGQRMVFISC---SGXRLKHLPEVKRFLYDVV-RPNLYHGVTVDFTP 76 Q+ A P Y+L E V C G RL P + ++ RP L ++ + Sbjct: 184539 QDRAEVPVYQLREGVDTAV--PCRPNGGIRL*DRPVASQTCEQLLLRPALVRNLSCNLAE 184712 Query: 77 GRSPA-------AYLYDADNQLVDDG 95 GRSPA L A + + DDG Sbjct: 184713 GRSPAKRHDTHHTILRVASSSVFDDG 184790 Score = 26.2 bits (56), Expect = 7.9 Identities = 14/28 (50%), Positives = 15/28 (53%) Frame = -2 Query: 2 RFPTLASLLLLLTVAGAAAQEAASAPAY 29 R P LLLL AGAAA + S AY Sbjct: 181159 RNPKRLQFLLLLAAAGAAAPQTRSISAY 181076 Database: L.donovani_BPK282A1/genome.fa Posted date: Nov 21, 2011 7:46 PM Number of letters in database: 32,444,998 Number of sequences in database: 36 Lambda K H 0.319 0.135 0.393 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 5,020,178 Number of Sequences: 36 Number of extensions: 71229 Number of successful extensions: 437 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 5 Number of HSP's successfully gapped in prelim test: 1 Number of HSP's that attempted gapping in prelim test: 425 Number of HSP's gapped (non-prelim): 34 length of query: 140 length of database: 10,814,999 effective HSP length: 90 effective length of query: 50 effective length of database: 10,811,759 effective search space: 540587950 effective search space used: 540587950 frameshift window, decay const: 40, 0.1 T: 13 A: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 55 (25.8 bits)