TBLASTN 2.2.13 [Nov-27-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Bos taurus (119 letters) Database: S.arctica/genome.fa 15,618 sequences; 121,588,341 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value supercont1.403 of Sphaeroforma arctica JP610 28 5.1 supercont1.184 of Sphaeroforma arctica JP610 27 6.7 supercont1.492 of Sphaeroforma arctica JP610 27 8.7 >supercont1.403 of Sphaeroforma arctica JP610 Length = 77443 Score = 27.7 bits (60), Expect = 5.1 Identities = 15/37 (40%), Positives = 21/37 (56%) Frame = -2 Query: 72 SDMTREEINALVQELGFYRKASPDEPVPPEYLRAPAR 108 ++ T + + LVQE+G KASP P P+ L A R Sbjct: 42006 NEFTNKIVELLVQEVGMLHKASP--PYRPQVLGAAER 41902 >supercont1.184 of Sphaeroforma arctica JP610 Length = 121854 Score = 27.3 bits (59), Expect = 6.7 Identities = 13/28 (46%), Positives = 16/28 (57%) Frame = -2 Query: 89 YRKASPDEPVPPEYLRAPARPAGDAPDH 116 YR+ +P P+PP RAP G A DH Sbjct: 40337 YRRTNPMSPMPP---RAPEARGGVAQDH 40263 >supercont1.492 of Sphaeroforma arctica JP610 Length = 68151 Score = 26.9 bits (58), Expect = 8.7 Identities = 18/48 (37%), Positives = 27/48 (56%), Gaps = 1/48 (2%) Frame = +1 Query: 12 ARARVETCGGXQ-LNRLKEVKAFVTQDIPLYHNLVMKHLPGADPELVL 58 ARA V Q + R KEV+ + ++ I +Y N V++ P +D LVL Sbjct: 38113 ARALVRDDAAFQRVQRAKEVRDYSSRRISIYVNNVLRR*PESDLGLVL 38256 Database: S.arctica/genome.fa Posted date: Nov 21, 2011 7:47 PM Number of letters in database: 121,588,341 Number of sequences in database: 15,618 Lambda K H 0.320 0.140 0.428 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 15,534,123 Number of Sequences: 15618 Number of extensions: 183336 Number of successful extensions: 843 Number of sequences better than 10.0: 4 Number of HSP's better than 10.0 without gapping: 797 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 843 length of query: 119 length of database: 40,529,447 effective HSP length: 93 effective length of query: 26 effective length of database: 39,076,973 effective search space: 1016001298 effective search space used: 1016001298 frameshift window, decay const: 40, 0.1 T: 13 A: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 58 (26.9 bits)