TBLASTN 2.2.13 [Nov-27-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Bos taurus (119 letters) Database: A.rara/genome.fa 3231 sequences; 1,450,095 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gi|330847447|gb|ADNL01003156.1| Astrammina rara contig02683, who... 24 1.1 gi|330850394|gb|ADNL01000209.1| Astrammina rara contig00219, who... 23 1.4 gi|330847872|gb|ADNL01002731.1| Astrammina rara contig03220, who... 22 3.2 gi|330849874|gb|ADNL01000729.1| Astrammina rara contig00833, who... 22 4.2 gi|330849160|gb|ADNL01001443.1| Astrammina rara contig01712, who... 22 5.5 gi|330850216|gb|ADNL01000387.1| Astrammina rara contig00421, who... 21 7.2 gi|330848380|gb|ADNL01002223.1| Astrammina rara contig02656, who... 21 9.3 gi|330850334|gb|ADNL01000269.1| Astrammina rara contig00280, who... 21 9.3 >gi|330847447|gb|ADNL01003156.1| Astrammina rara contig02683, whole genome shotgun sequence Length = 2184 Score = 23.9 bits (50), Expect = 1.1 Identities = 10/27 (37%), Positives = 14/27 (51%), Gaps = 5/27 (18%) Frame = -3 Query: 97 PVPPEYLRAPARPAGDAPD-----HAD 118 P PP Y++ P + + PD HAD Sbjct: 1168 PAPPAYIKEPVKLVPNVPD*FSKSHAD 1088 >gi|330850394|gb|ADNL01000209.1| Astrammina rara contig00219, whole genome shotgun sequence Length = 6385 Score = 23.5 bits (49), Expect = 1.4 Identities = 13/29 (44%), Positives = 16/29 (55%) Frame = -2 Query: 8 LQGLARARVETCGGXQLNRLKEVKAFVTQ 36 L GLAR R C G L LKE +A + + Sbjct: 5907 LIGLARFRGGQCLGEYLTALKEGEALIAK 5821 >gi|330847872|gb|ADNL01002731.1| Astrammina rara contig03220, whole genome shotgun sequence Length = 1679 Score = 22.3 bits (46), Expect = 3.2 Identities = 7/12 (58%), Positives = 9/12 (75%) Frame = +2 Query: 39 PLYHNLVMKHLP 50 P+YHNL + H P Sbjct: 515 PVYHNLTVDHSP 550 >gi|330849874|gb|ADNL01000729.1| Astrammina rara contig00833, whole genome shotgun sequence Length = 718 Score = 21.9 bits (45), Expect = 4.2 Identities = 10/28 (35%), Positives = 15/28 (53%) Frame = -1 Query: 40 LYHNLVMKHLPGADPELVLLGHRFEELE 67 L+H + + LPGA P L + E +E Sbjct: 706 LFHKVSKRFLPGAPPPLTPATVK*ESIE 623 >gi|330849160|gb|ADNL01001443.1| Astrammina rara contig01712, whole genome shotgun sequence Length = 140 Score = 21.6 bits (44), Expect = 5.5 Identities = 7/13 (53%), Positives = 9/13 (69%) Frame = +2 Query: 90 RKASPDEPVPPEY 102 R + P EPV P+Y Sbjct: 35 RSSEPSEPVKPQY 73 >gi|330850216|gb|ADNL01000387.1| Astrammina rara contig00421, whole genome shotgun sequence Length = 1448 Score = 21.2 bits (43), Expect = 7.2 Identities = 10/36 (27%), Positives = 17/36 (47%) Frame = -2 Query: 41 YHNLVMKHLPGADPELVLLGHRFEELERIPLSDMTR 76 YH L ++ L + LVL+ + +P S + R Sbjct: 334 YHTLHLRRLGQVELSLVLVVRHISAAQPVPQSTIPR 227 >gi|330848380|gb|ADNL01002223.1| Astrammina rara contig02656, whole genome shotgun sequence Length = 1281 Score = 20.8 bits (42), Expect = 9.3 Identities = 15/43 (34%), Positives = 20/43 (46%) Frame = +3 Query: 21 GXQLNRLKEVKAFVTQDIPLYHNLVMKHLPGADPELVLLGHRF 63 G L+R E F D H+LVM + G P ++GH F Sbjct: 339 GEILHRTDEY--FSQYDCCSIHSLVMN*V*GYYPFTGIIGHEF 461 >gi|330850334|gb|ADNL01000269.1| Astrammina rara contig00280, whole genome shotgun sequence Length = 4054 Score = 20.8 bits (42), Expect = 9.3 Identities = 7/12 (58%), Positives = 9/12 (75%) Frame = +3 Query: 38 IPLYHNLVMKHL 49 IP+YH+ V HL Sbjct: 2526 IPMYHHQVQHHL 2561 Database: A.rara/genome.fa Posted date: Nov 21, 2011 7:46 PM Number of letters in database: 1,450,095 Number of sequences in database: 3231 Lambda K H 0.320 0.140 0.428 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 178,624 Number of Sequences: 3231 Number of extensions: 1764 Number of successful extensions: 12 Number of sequences better than 10.0: 8 Number of HSP's better than 10.0 without gapping: 12 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 12 length of query: 119 length of database: 483,365 effective HSP length: 64 effective length of query: 55 effective length of database: 276,581 effective search space: 15211955 effective search space used: 15211955 frameshift window, decay const: 40, 0.1 T: 13 A: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 42 (20.8 bits)