TBLASTN 2.2.13 [Nov-27-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= thalassiosira pseudonana (171 letters) Database: L.tarentolae/genome.fa 7267 sequences; 31,598,840 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Lt_contig5364 | | 1 to 8375 30 1.0 Lt_contig3494 | | 1 to 6465 30 1.0 Lt_contig7138 | | 1 to 11915 29 1.3 Lt_contig1033 | | 1 to 3991 28 3.0 Lt_contig5713 | | 1 to 11838 27 6.7 Lt_contig3961 | | 1 to 1048 27 8.7 Lt_contig33 | | 1 to 15443 27 8.7 >Lt_contig5364 | | 1 to 8375 Length = 8375 Score = 29.6 bits (65), Expect = 1.0 Identities = 21/82 (25%), Positives = 35/82 (42%) Frame = +3 Query: 70 KRAVLTIFEGGRELEKITLSDYNDKEKLHTLFAEKGFVKYTGVELAERRKVEAEETGSLQ 129 K+A ++ G + +D + LHTL + + ERR+V A G Q Sbjct: 7767 KQAEMSAVNGDVSCVRAGCADDAKRRMLHTLLHRPANMS----QRIERRQVNARRCGQRQ 7934 Query: 130 KTLEAQRYSLSKREQKLQMKER 151 KT + Q+ + K+ L +R Sbjct: 7935 KTQQQQQQPVHKKSSCLPSHQR 8000 >Lt_contig3494 | | 1 to 6465 Length = 6465 Score = 29.6 bits (65), Expect = 1.0 Identities = 21/82 (25%), Positives = 35/82 (42%) Frame = -3 Query: 70 KRAVLTIFEGGRELEKITLSDYNDKEKLHTLFAEKGFVKYTGVELAERRKVEAEETGSLQ 129 K+A ++ G + +D + LHTL + + ERR+V A G Q Sbjct: 2899 KQAEMSAVNGDVSCVRAGCADDAKRRMLHTLLHRPANMS----QRIERRQVNARRCGQRQ 2732 Query: 130 KTLEAQRYSLSKREQKLQMKER 151 KT + Q+ + K+ L +R Sbjct: 2731 KTQQQQQQPVHKKSSCLPSHQR 2666 >Lt_contig7138 | | 1 to 11915 Length = 11915 Score = 29.3 bits (64), Expect = 1.3 Identities = 32/136 (23%), Positives = 56/136 (41%), Gaps = 8/136 (5%) Frame = -3 Query: 24 QEQRLTGLIESCSGXALNRLPELKSFLKDLNGVDLYKNVEV------HFISGKRAVLTIF 77 Q + +E ALN+L E L L D Y+N+++ H I R + Sbjct: 9057 QHEERYNALEKRMADALNQLNEKDEQLHHLTSADDYENLKLEQESLTHEIDLYRQRIAFL 8878 Query: 78 EGGRELEKITLSD--YNDKEKLHTLFAEKGFVKYTGVELAERRKVEAEETGSLQKTLEAQ 135 E R+ S+ ++ + L TL A K + K+E E + +AQ Sbjct: 8877 ETNRKTFDDAASETALDETKVLETLSASKERIS----------KLEFERDQLAVQLQQAQ 8728 Query: 136 RYSLSKREQKLQMKER 151 Y++S+ + Q+++R Sbjct: 8727 TYAVSRDAEARQLQQR 8680 >Lt_contig1033 | | 1 to 3991 Length = 3991 Score = 28.1 bits (61), Expect = 3.0 Identities = 16/56 (28%), Positives = 31/56 (55%), Gaps = 1/56 (1%) Frame = -2 Query: 22 DAQEQRLTGLIESCSGXALNRLPELKSFLKDLNGVDLYKNVEVHFIS-GKRAVLTI 76 DA Q L + ++ + ++LP+++ + +NG Y+ VEV + G + VLT+ Sbjct: 2289 DALPQPLKTVTQTSTVTGSSQLPQVEKTTQGMNGNSAYEAVEVMVVDRGTQTVLTV 2122 >Lt_contig5713 | | 1 to 11838 Length = 11838 Score = 26.9 bits (58), Expect = 6.7 Identities = 15/37 (40%), Positives = 22/37 (59%), Gaps = 2/37 (5%) Frame = -1 Query: 104 KGFVKYTGVELAE--RRKVEAEETGSLQKTLEAQRYS 138 KGF T +A +R ++AEE SLQ+ L A+ Y+ Sbjct: 9633 KGFDPETAAFMASASKRSIDAEEDTSLQEALTAELYA 9523 >Lt_contig3961 | | 1 to 1048 Length = 1048 Score = 26.6 bits (57), Expect = 8.7 Identities = 17/46 (36%), Positives = 24/46 (52%), Gaps = 2/46 (4%) Frame = +1 Query: 78 EGGRELEKITLSDYNDKEKLHTLFAE--KGFVKYTGVELAERRKVE 121 EGG+E I + YND T F++ K KY + ++RKVE Sbjct: 907 EGGKESMSIFICAYNDTFTALTSFSKHTKKRAKYRARKKKKKRKVE 1044 >Lt_contig33 | | 1 to 15443 Length = 15443 Score = 26.6 bits (57), Expect = 8.7 Identities = 20/48 (41%), Positives = 25/48 (52%), Gaps = 5/48 (10%) Frame = +3 Query: 6 IFPPVLLFLSM-----LLVWSDAQEQRLTGLIESCSGXALNRLPELKS 48 IFPP+ L+L M LL +R+ LI CSG A RLP K+ Sbjct: 12972 IFPPLQLWLCMRTSSFLLQSVCVHPRRVCRLI--CSGPARGRLPRAKA 13109 Database: L.tarentolae/genome.fa Posted date: Nov 21, 2011 7:46 PM Number of letters in database: 31,598,840 Number of sequences in database: 7267 Lambda K H 0.318 0.135 0.370 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 4,539,432 Number of Sequences: 7267 Number of extensions: 48765 Number of successful extensions: 264 Number of sequences better than 10.0: 7 Number of HSP's better than 10.0 without gapping: 261 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 264 length of query: 171 length of database: 10,532,946 effective HSP length: 92 effective length of query: 79 effective length of database: 9,864,382 effective search space: 779286178 effective search space used: 779286178 frameshift window, decay const: 40, 0.1 T: 13 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 57 (26.6 bits)