TBLASTN 2.2.13 [Nov-27-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= gi|323451426|gb|EGB07303.1| selenoprotein [Aureococcus anophagefferens] (128 letters) Database: L.donovani_BPK282A1/genome.fa 36 sequences; 32,444,998 total letters Searching....................................done Score E Sequences producing significant alignments: (bits) Value contig_21 32 0.15 contig_31 31 0.20 contig_18 29 0.98 contig_10 28 1.7 contig_01 27 3.7 contig_26 27 4.8 contig_28 26 6.3 contig_17 26 6.3 contig_35 26 8.3 contig_16 26 8.3 >contig_21 Length = 767234 Score = 31.6 bits (70), Expect = 0.15 Identities = 17/50 (34%), Positives = 23/50 (46%) Frame = -3 Query: 6 VLACAAALAAAATGKIETCSAXKLNKLPEVKRFVKESGHADTYEGLEIDY 55 + AC A G + T S KL EV R +K GH E LE+++ Sbjct: 715551 IAACVFRHQAGRVGTMPTSSGVDQAKLREVIRVLKSVGHVGMAESLEVEW 715402 >contig_31 Length = 1531288 Score = 31.2 bits (69), Expect = 0.20 Identities = 27/99 (27%), Positives = 39/99 (39%), Gaps = 1/99 (1%) Frame = +2 Query: 11 AALAAAATGKIETCSAXKLNKLPEVKRFVKESGHADTYEGLEIDYVRGKP-PTLIMMDGD 69 AAL A+ +E S + + K V + + DT+ G P P + GD Sbjct: 1332095 AALTASVVVVVEGSSGHRGGGRGKKKADVTSTDNDDTHSRTRSRGQEGAPLPVRTLRCGD 1332274 Query: 70 AEVERVDLAPYSTDELHALMQEKGFARKEAEPAGTREQV 108 AE+ DLA T E H L+ G + E R + Sbjct: 1332275 AELATPDLASEKTGERHVLVGGHGQEHEGVEHQSCRHDL 1332391 >contig_18 Length = 735640 Score = 28.9 bits (63), Expect = 0.98 Identities = 13/33 (39%), Positives = 20/33 (60%) Frame = -2 Query: 5 LVLACAAALAAAATGKIETCSAXKLNKLPEVKR 37 +VLACAA + AA G + +C + N+L +R Sbjct: 305811 VVLACAAEVTLAAAGGMGSCRSRARNQLSSTRR 305713 >contig_10 Length = 558170 Score = 28.1 bits (61), Expect = 1.7 Identities = 16/37 (43%), Positives = 19/37 (51%) Frame = -3 Query: 1 MLRRLVLACAAALAAAATGKIETCSAXKLNKLPEVKR 37 +LR +V ACAAA AAA + C PE KR Sbjct: 355614 LLRHVVPACAAAAAAAERQRSPRCGRHSAPLPPEHKR 355504 Score = 26.2 bits (56), Expect = 6.3 Identities = 14/46 (30%), Positives = 23/46 (50%) Frame = -3 Query: 58 GKPPTLIMMDGDAEVERVDLAPYSTDELHALMQEKGFARKEAEPAG 103 G+P ++++ DAEVER LA + L + +G R + G Sbjct: 151512 GRPYSMMIAPRDAEVERPRLAKPAISAYTTLSEPRGHRRDSSTTIG 151375 >contig_01 Length = 283432 Score = 26.9 bits (58), Expect = 3.7 Identities = 16/37 (43%), Positives = 23/37 (62%), Gaps = 1/37 (2%) Frame = +1 Query: 83 DELHALMQEKGFARKEAEP-AGTREQVLHRAPRSAQA 118 +E+HA + + +R+ EP AG + VLHR R AQA Sbjct: 244873 EEVHA--RPRAHSREAREPDAGGHQAVLHRRRRGAQA 244977 >contig_26 Length = 1058259 Score = 26.6 bits (57), Expect = 4.8 Identities = 12/45 (26%), Positives = 24/45 (53%) Frame = -1 Query: 47 TYEGLEIDYVRGKPPTLIMMDGDAEVERVDLAPYSTDELHALMQE 91 T+E + + G+PP + + G+AEV+ D + +T L+ + Sbjct: 1015863 TWESSLLSFSPGRPPRMPRLPGEAEVDGEDESIMTTSSSEPLISQ 1015729 >contig_28 Length = 1171725 Score = 26.2 bits (56), Expect = 6.3 Identities = 19/47 (40%), Positives = 22/47 (46%) Frame = +3 Query: 80 YSTDELHALMQEKGFARKEAEPAGTREQVLHRAPRSAQADAVADAET 126 YS D HA +++ AEPAG R LHR R D V ET Sbjct: 525144 YSYD--HAGSRQQRPTETPAEPAGQRR*ELHRQLRLLL*DGVGGIET 525278 Score = 25.8 bits (55), Expect = 8.3 Identities = 12/26 (46%), Positives = 15/26 (57%) Frame = -1 Query: 8 ACAAALAAAATGKIETCSAXKLNKLP 33 AC +A AAATG +CSA + P Sbjct: 482700 ACESATRAAATGDSRSCSARRERTQP 482623 >contig_17 Length = 671483 Score = 26.2 bits (56), Expect = 6.3 Identities = 16/55 (29%), Positives = 20/55 (36%), Gaps = 6/55 (10%) Frame = +3 Query: 4 RLVLACAAALAAAATGKIETCSAXKLNKLPEVKRFVKESG------HADTYEGLE 52 R CA+ A + C + +LP V R G DTYEG E Sbjct: 640965 RRCFCCASRQRHVAIAAVAACRCGRKGRLPRVYRHYYRMG*VHMDAFGDTYEGSE 641129 >contig_35 Length = 2113966 Score = 25.8 bits (55), Expect = 8.3 Identities = 13/33 (39%), Positives = 17/33 (51%) Frame = -2 Query: 1 MLRRLVLACAAALAAAATGKIETCSAXKLNKLP 33 +LRR V ACAAA+A + +C L P Sbjct: 391377 ILRRCVEACAAAVAISLCSGSRSCGGVALTTSP 391279 >contig_16 Length = 698406 Score = 25.8 bits (55), Expect = 8.3 Identities = 18/61 (29%), Positives = 25/61 (40%) Frame = -3 Query: 58 GKPPTLIMMDGDAEVERVDLAPYSTDELHALMQEKGFARKEAEPAGTREQVLHRAPRSAQ 117 GK P+ G EV+RV +E+G ARK+ E G + Q + Q Sbjct: 673387 GKRPSWAARGGCGEVDRVS-------------EERGVARKKREAKGKKRQQSSKGKDERQ 673247 Query: 118 A 118 A Sbjct: 673246 A 673244 Database: L.donovani_BPK282A1/genome.fa Posted date: Nov 21, 2011 7:46 PM Number of letters in database: 32,444,998 Number of sequences in database: 36 Lambda K H 0.315 0.129 0.358 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 6,401,144 Number of Sequences: 36 Number of extensions: 92171 Number of successful extensions: 632 Number of sequences better than 10.0: 10 Number of HSP's better than 10.0 without gapping: 9 Number of HSP's successfully gapped in prelim test: 4 Number of HSP's that attempted gapping in prelim test: 577 Number of HSP's gapped (non-prelim): 141 length of query: 128 length of database: 10,814,999 effective HSP length: 88 effective length of query: 40 effective length of database: 10,811,831 effective search space: 432473240 effective search space used: 432473240 frameshift window, decay const: 40, 0.1 T: 13 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.6 bits) S2: 54 (25.4 bits)