TBLASTN 2.2.13 [Nov-27-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= gi|323451426|gb|EGB07303.1| selenoprotein [Aureococcus anophagefferens] (128 letters) Database: D.fasciculatum/genome.fa 25 sequences; 31,019,208 total letters Searching.........................done Score E Sequences producing significant alignments: (bits) Value gi|328871378|gb|GL883013.1| Dictyostelium fasciculatum unplaced ... 27 4.6 gi|328869808|gb|GL883018.1| Dictyostelium fasciculatum unplaced ... 26 6.0 >gi|328871378|gb|GL883013.1| Dictyostelium fasciculatum unplaced genomic scaffold Scf_ET2XIPL01CNAVH-3, whole genome shotgun sequence Length = 1908399 Score = 26.6 bits (57), Expect = 4.6 Identities = 13/39 (33%), Positives = 22/39 (56%) Frame = +3 Query: 51 LEIDYVRGKPPTLIMMDGDAEVERVDLAPYSTDELHALM 89 +E+DY R + P L+MM ++ VD + Y T + +M Sbjct: 192198 IEVDYSRHQTPILVMMLVILQLIDVDYSYYQTSMIAMMM 192314 Score = 25.8 bits (55), Expect = 7.9 Identities = 10/39 (25%), Positives = 22/39 (56%) Frame = +2 Query: 51 LEIDYVRGKPPTLIMMDGDAEVERVDLAPYSTDELHALM 89 +E+DY+ + P ++MM+ ++ +D Y T + +M Sbjct: 81560 IEVDYIHHQTPMIVMMEVILQLILLDYIHYQTPMIVMMM 81676 Score = 25.8 bits (55), Expect = 7.9 Identities = 12/40 (30%), Positives = 21/40 (52%) Frame = -3 Query: 75 VDLAPYSTDELHALMQEKGFARKEAEPAGTREQVLHRAPR 114 + L +LH +Q+ RKE + ++Q+LH+ PR Sbjct: 217852 IPLQQLQLPQLHQQLQQL*MKRKERQLNQRQQQLLHQRPR 217733 >gi|328869808|gb|GL883018.1| Dictyostelium fasciculatum unplaced genomic scaffold Scf_Dfasci-G-b-285a01.f1-5, whole genome shotgun sequence Length = 1327167 Score = 26.2 bits (56), Expect = 6.0 Identities = 14/27 (51%), Positives = 16/27 (59%) Frame = +1 Query: 22 ETCSAXKLNKLPEVKRFVKESGHADTY 48 ET + KLN LP +KRF G AD Y Sbjct: 882964 ETTTTTKLNILPNLKRF---KGQADYY 883035 Database: D.fasciculatum/genome.fa Posted date: Nov 21, 2011 7:46 PM Number of letters in database: 31,019,208 Number of sequences in database: 25 Lambda K H 0.315 0.129 0.358 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 2,586,442 Number of Sequences: 25 Number of extensions: 23667 Number of successful extensions: 128 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 4 Number of HSP's successfully gapped in prelim test: 1 Number of HSP's that attempted gapping in prelim test: 111 Number of HSP's gapped (non-prelim): 43 length of query: 128 length of database: 10,339,736 effective HSP length: 88 effective length of query: 40 effective length of database: 10,337,536 effective search space: 413501440 effective search space used: 413501440 frameshift window, decay const: 40, 0.1 T: 13 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.6 bits) S2: 54 (25.4 bits)