TBLASTN 2.2.13 [Nov-27-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= gi|323451426|gb|EGB07303.1| selenoprotein [Aureococcus anophagefferens] (128 letters) Database: A.laibachii_Nc14/genome.fa 3816 sequences; 32,740,139 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gi|325194232|emb|FR825089.1| Albugo laibachii Nc14, genomic cont... 27 2.8 gi|325185424|emb|FR824127.1| Albugo laibachii Nc14, genomic cont... 26 8.1 gi|325187045|emb|FR824173.1| Albugo laibachii Nc14, genomic cont... 26 8.1 gi|325188096|emb|FR824207.1| Albugo laibachii Nc14, genomic cont... 26 8.1 >gi|325194232|emb|FR825089.1| Albugo laibachii Nc14, genomic contig CONTIG_1615_NC14_v4_1844_65 Length = 1844 Score = 27.3 bits (59), Expect = 2.8 Identities = 11/40 (27%), Positives = 21/40 (52%) Frame = -1 Query: 75 VDLAPYSTDELHALMQEKGFARKEAEPAGTREQVLHRAPR 114 +DL + + ++ +GF R+ ++ G Q +HRA R Sbjct: 776 LDLQGHGKQAIRTAVESQGFGRRTSKRKGFSNQEIHRAQR 657 >gi|325185424|emb|FR824127.1| Albugo laibachii Nc14, genomic contig CONTIG_82_NC14_v4_91335_233 Length = 91335 Score = 25.8 bits (55), Expect = 8.1 Identities = 11/14 (78%), Positives = 13/14 (92%) Frame = -3 Query: 109 LHRAPRSAQADAVA 122 LHRAPR++QA AVA Sbjct: 48772 LHRAPRASQAPAVA 48731 >gi|325187045|emb|FR824173.1| Albugo laibachii Nc14, genomic contig CONTIG_128_NC14_v4_69976_248 Length = 69976 Score = 25.8 bits (55), Expect = 8.1 Identities = 15/37 (40%), Positives = 17/37 (45%), Gaps = 3/37 (8%) Frame = -2 Query: 1 MLRRLVLACAAALAAAATGKIETCSAXK---LNKLPE 34 M R LVL CA A G TCS+ N LP+ Sbjct: 60255 MRRHLVLLCAVACRTVKLGASRTCSSLHGPYCNHLPQ 60145 >gi|325188096|emb|FR824207.1| Albugo laibachii Nc14, genomic contig CONTIG_162_NC14_v4_57516_227 Length = 57516 Score = 25.8 bits (55), Expect = 8.1 Identities = 13/36 (36%), Positives = 19/36 (52%) Frame = +3 Query: 76 DLAPYSTDELHALMQEKGFARKEAEPAGTREQVLHR 111 D Y+ +ELHAL + G A K+ ++ LHR Sbjct: 15798 DFTLYNGEELHALSMQTGNALKDVLKQLPEQKDLHR 15905 Database: A.laibachii_Nc14/genome.fa Posted date: Nov 21, 2011 7:46 PM Number of letters in database: 32,740,139 Number of sequences in database: 3816 Lambda K H 0.315 0.129 0.358 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 3,526,655 Number of Sequences: 3816 Number of extensions: 35731 Number of successful extensions: 154 Number of sequences better than 10.0: 4 Number of HSP's better than 10.0 without gapping: 147 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 154 length of query: 128 length of database: 10,913,379 effective HSP length: 88 effective length of query: 40 effective length of database: 10,577,571 effective search space: 423102840 effective search space used: 423102840 frameshift window, decay const: 40, 0.1 T: 13 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.6 bits) S2: 54 (25.4 bits)